ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6720

Name

SREBF1

Synonym

SREBP-1c|SREBP1|bHLHd1;sterol regulatory element binding transcription factor 1;SREBF1;sterol regulatory element binding transcription factor 1

Definition

SREBP-1|class D basic helix-loop-helix protein 1|sterol regulatory element-binding protein 1

Position

17p11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

RXR and RAR heterodimerization with other nuclear receptor;PID Curated;200112

Pathway

Caspase cascade in apoptosis;PID Curated;200148

Pathway

srebp control of lipid synthesis;PID BioCarta;100038

Pathway

caspase cascade in apoptosis;PID BioCarta;100218

Pathway

mTOR signaling pathway;PID Curated;200080

Disease

Atherosclerosis;GAD

Disease

diabetes, type 2;GAD

Disease

CARDIOVASCULAR;GAD

Disease

obesity;GAD

Disease

METABOLIC;GAD

External Links

Links to cell senescence gene database

6720

Links to epithelial mesenchymal transition gene database

6720

Links to ovarian cancer gene database

6720

Links to endometrial cancer gene database

6720

Links to iHOP

6720

Sequence Information

Nucleotide Sequence

>6720 : length: 5012
AGCAGAGCTGCGGCCGGGGGAACCCAGTTTCCGAGGAACTTTTCGCCGGCGCCGGGCCGC
CTCTGAGGCCAGGGCAGGACACGAACGCGCGGAGCGGCGGCGGCGACTGAGAGCCGGGGC
CGCGGCGGCGCTCCCTAGGAAGGGCCGTACGAGGCGGCGGGCCCGGCGGGCCTCCCGGAG
GAGGCGGCTGCGCCATGGACGAGCCACCCTTCAGCGAGGCGGCTTTGGAGCAGGCGCTGG
GCGAGCCGTGCGATCTGGACGCGGCGCTGCTGACCGACATCGAAGGTGAAGTCGGCGCGG
GGAGGGGTAGGGCCAACGGCCTGGACGCCCCAAGGGCGGGCGCAGATCGCGGAGCCATGG
ATTGCACTTTCGAAGACATGCTTCAGCTTATCAACAACCAAGACAGTGACTTCCCTGGCC
TATTTGACCCACCCTATGCTGGGAGTGGGGCAGGGGGCACAGACCCTGCCAGCCCCGATA
CCAGCTCCCCAGGCAGCTTGTCTCCACCTCCTGCCACATTGAGCTCCTCTCTTGAAGCCT
TCCTGAGCGGGCCGCAGGCAGCGCCCTCACCCCTGTCCCCTCCCCAGCCTGCACCCACTC
CATTGAAGATGTACCCGTCCATGCCCGCTTTCTCCCCTGGGCCTGGTATCAAGGAAGAGT
CAGTGCCACTGAGCATCCTGCAGACCCCCACCCCACAGCCCCTGCCAGGGGCCCTCCTGC
CACAGAGCTTCCCAGCCCCAGCCCCACCGCAGTTCAGCTCCACCCCTGTGTTAGGCTACC
CCAGCCCTCCGGGAGGCTTCTCTACAGGAAGCCCTCCCGGGAACACCCAGCAGCCGCTGC
CTGGCCTGCCACTGGCTTCCCCGCCAGGGGTCCCGCCCGTCTCCTTGCACACCCAGGTCC
AGAGTGTGGTCCCCCAGCAGCTACTGACAGTCACAGCTGCCCCCACGGCAGCCCCTGTAA
CGACCACTGTGACCTCGCAGATCCAGCAGGTCCCGGTCCTGCTGCAGCCCCACTTCATCA
AGGCAGACTCGCTGCTTCTGACAGCCATGAAGACAGACGGAGCCACTGTGAAGGCGGCAG
GTCTCAGTCCCCTGGTCTCTGGCACCACTGTGCAGACAGGGCCTTTGCCGACCCTGGTGA
GTGGCGGAACCATCTTGGCAACAGTCCCACTGGTCGTAGATGCGGAGAAGCTGCCTATCA
ACCGGCTCGCAGCTGGCAGCAAGGCCCCGGCCTCTGCCCAGAGCCGTGGAGAGAAGCGCA
CAGCCCACAACGCCATTGAGAAGCGCTACCGCTCCTCCATCAATGACAAAATCATTGAGC
TCAAGGATCTGGTGGTGGGCACTGAGGCAAAGCTGAATAAATCTGCTGTCTTGCGCAAGG
CCATCGACTACATTCGCTTTCTGCAACACAGCAACCAGAAACTCAAGCAGGAGAACCTAA
GTCTGCGCACTGCTGTCCACAAAAGCAAATCTCTGAAGGATCTGGTGTCGGCCTGTGGCA
GTGGAGGGAACACAGACGTGCTCATGGAGGGCGTGAAGACTGAGGTGGAGGACACACTGA
CCCCACCCCCCTCGGATGCTGGCTCACCTTTCCAGAGCAGCCCCTTGTCCCTTGGCAGCA
GGGGCAGTGGCAGCGGTGGCAGTGGCAGTGACTCGGAGCCTGACAGCCCAGTCTTTGAGG
ACAGCAAGGCAAAGCCAGAGCAGCGGCCGTCTCTGCACAGCCGGGGCATGCTGGACCGCT
CCCGCCTGGCCCTGTGCACGCTCGTCTTCCTCTGCCTGTCCTGCAACCCCTTGGCCTCCT
TGCTGGGGGCCCGGGGGCTTCCCAGCCCCTCAGATACCACCAGCGTCTACCATAGCCCTG
GGCGCAACGTGCTGGGCACCGAGAGCAGAGATGGCCCTGGCTGGGCCCAGTGGCTGCTGC
CCCCAGTGGTCTGGCTGCTCAATGGGCTGTTGGTGCTCGTCTCCTTGGTGCTTCTCTTTG
TCTACGGTGAGCCAGTCACACGGCCCCACTCAGGCCCCGCCGTGTACTTCTGGAGGCATC
GCAAGCAGGCTGACCTGGACCTGGCCCGGGGAGACTTTGCCCAGGCTGCCCAGCAGCTGT
GGCTGGCCCTGCGGGCACTGGGCCGGCCCCTGCCCACCTCCCACCTGGACCTGGCTTGTA
GCCTCCTCTGGAACCTCATCCGTCACCTGCTGCAGCGTCTCTGGGTGGGCCGCTGGCTGG
CAGGCCGGGCAGGGGGCCTGCAGCAGGACTGTGCTCTGCGAGTGGATGCTAGCGCCAGCG
CCCGAGACGCAGCCCTGGTCTACCATAAGCTGCACCAGCTGCACACCATGGGGAAGCACA
CAGGCGGGCACCTCACTGCCACCAACCTGGCGCTGAGTGCCCTGAACCTGGCAGAGTGTG
CAGGGGATGCCGTGTCTGTGGCGACGCTGGCCGAGATCTATGTGGCGGCTGCATTGAGAG
TGAAGACCAGTCTCCCACGGGCCTTGCATTTTCTGACACGCTTCTTCCTGAGCAGTGCCC
GCCAGGCCTGCCTGGCACAGAGTGGCTCAGTGCCTCCTGCCATGCAGTGGCTCTGCCACC
CCGTGGGCCACCGTTTCTTCGTGGATGGGGACTGGTCCGTGCTCAGTACCCCATGGGAGA
GCCTGTACAGCTTGGCCGGGAACCCAGTGGACCCCCTGGCCCAGGTGACTCAGCTATTCC
GGGAACATCTCTTAGAGCGAGCACTGAACTGTGTGACCCAGCCCAACCCCAGCCCTGGGT
CAGCTGATGGGGACAAGGAATTCTCGGATGCCCTCGGGTACCTGCAGCTGCTGAACAGCT
GTTCTGATGCTGCGGGGGCTCCTGCCTACAGCTTCTCCATCAGTTCCAGCATGGCCACCA
CCACCGGCGTAGACCCGGTGGCCAAGTGGTGGGCCTCTCTGACAGCTGTGGTGATCCACT
GGCTGCGGCGGGATGAGGAGGCGGCTGAGCGGCTGTGCCCGCTGGTGGAGCACCTGCCCC
GGGTGCTGCAGGAGTCTGAGAGACCCCTGCCCAGGGCAGCTCTGCACTCCTTCAAGGCTG
CCCGGGCCCTGCTGGGCTGTGCCAAGGCAGAGTCTGGTCCAGCCAGCCTGACCATCTGTG
AGAAGGCCAGTGGGTACCTGCAGGACAGCCTGGCTACCACACCAGCCAGCAGCTCCATTG
ACAAGGCCGTGCAGCTGTTCCTGTGTGACCTGCTTCTTGTGGTGCGCACCAGCCTGTGGC
GGCAGCAGCAGCCCCCGGCCCCGGCCCCAGCAGCCCAGGGCACCAGCAGCAGGCCCCAGG
CTTCCGCCCTTGAGCTGCGTGGCTTCCAACGGGACCTGAGCAGCCTGAGGCGGCTGGCAC
AGAGCTTCCGGCCCGCCATGCGGAGGGTGTTCCTACATGAGGCCACGGCCCGGCTGATGG
CGGGGGCCAGCCCCACACGGACACACCAGCTCCTCGACCGCAGTCTGAGGCGGCGGGCAG
GCCCCGGTGGCAAAGGAGGCGCGGTGGCGGAGCTGGAGCCGCGGCCCACGCGGCGGGAGC
ACGCGGAGGCCTTGCTGCTGGCCTCCTGCTACCTGCCCCCCGGCTTCCTGTCGGCGCCCG
GGCAGCGCGTGGGCATGCTGGCTGAGGCGGCGCGCACACTCGAGAAGCTTGGCGATCGCC
GGCTGCTGCACGACTGTCAGCAGATGCTCATGCGCCTGGGCGGTGGGACCACTGTCACTT
CCAGCTAGACCCCGTGTCCCCGGCCTCAGCACCCCTGTCTCTAGCCACTTTGGTCCCGTG
CAGCTTCTGTCCTGCGTCGAAGCTTTGAAGGCCGAAGGCAGTGCAAGAGACTCTGGCCTC
CACAGTTCGACCTGCGGCTGCTGTGTGCCTTCGCGGTGGAAGGCCCGAGGGGCGCGATCT
TGACCCTAAGACCGGCGGCCATGATGGTGCTGACCTCTGGTGGCCGATCGGGGCACTGCA
GGGGCCGAGCCATTTTGGGGGGCCCCCCTCCTTGCTCTGCAGGCACCTTAGTGGCTTTTT
TCCTCCTGTGTACAGGGAAGAGAGGGGTACATTTCCCTGTGCTGACGGAAGCCAACTTGG
CTTTCCCGGACTGCAAGCAGGGCTCTGCCCCAGAGGCCTCTCTCTCCGTCGTGGGAGAGA
GACGTGTACATAGTGTAGGTCAGCGTGCTTAGCCTCCTGACCTGAGGCTCCTGTGCTACT
TTGCCTTTTGCAAACTTTATTTTCATAGATTGAGAAGTTTTGTACAGAGAATTAAAAATG
AAATTATTTATAATCTGGGTTTTGTGTCTTCAGCTGATGGATGTGCTGACTAGTGAGAGT
GCTTGGGCCCTCCCCCAGCACCTAGGGAAAGGCTTCCCCTCCCCCTCCGGCCACAAGGTA
CACAACTTTTAACTTAGCTCTTCCCGATGTTTGTTTGTTAGTGGGAGGAGTGGGGAGGGC
TGGCTGTATGGCCTCCAGCCTACCTGTTCCCCCTGCTCCCAGGGCACATGGTTGGGCTGT
GTCAACCCTTAGGGCCTCCATGGGGTCAGTTGTCCCTTCTCACCTCCCAGCTCTGTCCCC
ATCAGGTCCCTGGGTGGCACGGGAGGATGGACTGACTTCCAGGACCTGTTGTGTGACAGG
AGCTACAGCTTGGGTCTCCCTGCAAGAAGTCTGGCACGTCTCACCTCCCCCATCCCGGCC
CCTGGTCATCTCACAGCAAAGAAGCCTCCTCCCTCCCGACCTGCCGCCACACTGGAGAGG
GGGCACAGGGGCGGGGGAGGTTTCCTGTTCTGTGAAAGGCCGACTCCCTGACTCCATTCA
TGCCCCCCCCCCCAGCCCCTCCCTTCATTCCCATTCCCCAACCTAAAGCCTGGCCCGGCT
CCCAGCTGAATCTGGTCGGAATCCACGGGCTGCAGATTTTCCAAAACAATCGTTGTATCT
TTATTGACTTTTTTTTTTTTTTTTTTCTGAATGCAATGACTGTTTTTTACTCTTAAGGAA
AATAAACATCTTTTAGAAACAAAAAAAAAAAA

Protein Sequence

>6720 : length: 1177
MDEPPFSEAALEQALGEPCDLDAALLTDIEGEVGAGRGRANGLDAPRAGADRGAMDCTFE
DMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGP
QAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFP
APAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVP
QQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPL
VSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNA
IEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTA
VHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGS
GGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLALCTLVFLCLSCNPLASLLGAR
GLPSPSDTTSVYHSPGRNVLGTESRDGPGWAQWLLPPVVWLLNGLLVLVSLVLLFVYGEP
VTRPHSGPAVYFWRHRKQADLDLARGDFAQAAQQLWLALRALGRPLPTSHLDLACSLLWN
LIRHLLQRLWVGRWLAGRAGGLQQDCALRVDASASARDAALVYHKLHQLHTMGKHTGGHL
TATNLALSALNLAECAGDAVSVATLAEIYVAAALRVKTSLPRALHFLTRFFLSSARQACL
AQSGSVPPAMQWLCHPVGHRFFVDGDWSVLSTPWESLYSLAGNPVDPLAQVTQLFREHLL
ERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVD
PVAKWWASLTAVVIHWLRRDEEAAERLCPLVEHLPRVLQESERPLPRAALHSFKAARALL
GCAKAESGPASLTICEKASGYLQDSLATTPASSSIDKAVQLFLCDLLLVVRTSLWRQQQP
PAPAPAAQGTSSRPQASALELRGFQRDLSSLRRLAQSFRPAMRRVFLHEATARLMAGASP
TRTHQLLDRSLRRRAGPGGKGGAVAELEPRPTRREHAEALLLASCYLPPGFLSAPGQRVG
MLAEAARTLEKLGDRRLLHDCQQMLMRLGGGTTVTSS