ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6714

Name

SRC

Synonym

ASV|SRC1|c-SRC|p60-Src;SRC proto-oncogene, non-receptor tyrosine kinase;SRC;SRC proto-oncogene, non-receptor tyrosine kinase

Definition

proto-oncogene c-Src|proto-oncogene tyrosine-protein kinase Src|protooncogene SRC, Rous sarcoma|tyrosine kinase pp60c-src|tyrosine-protein kinase SRC-1|v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog

Position

20q12-q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

S1P3 pathway;PID Curated;200035

Pathway

Regulation of p38-alpha and p38-beta;PID Curated;200054

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

sprouty regulation of tyrosine kinase signals;PID BioCarta;100029

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

Signaling by EGFR;Reactome;REACT:9417

Pathway

EPHB forward signaling;PID Curated;200041

Pathway

Syndecan-3-mediated signaling events;PID Curated;200170

Pathway

regulation of splicing through sam68;PID BioCarta;100036

Pathway

Glypican 1 network;PID Curated;200021

Pathway

EPHA2 forward signaling;PID Curated;200185

Pathway

Endothelins;PID Curated;200004

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

how progesterone initiates the oocyte maturation;PID BioCarta;100104

Pathway

E-cadherin signaling in the nascent adherens junction;PID Curated;200105

Pathway

EPHA forward signaling;PID Curated;200121

Pathway

erk1/erk2 mapk signaling pathway;PID BioCarta;100170

Pathway

Paxillin-independent events mediated by a4b1 and a4b7;PID Curated;200178

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

ADP signalling through P2Y purinoceptor 1;PID Reactome;500292

Pathway

Interactions of the immunoglobulin superfamily (IgSF) member proteins;Reactome;REACT:23853

Pathway

Signaling events mediated by TCPTP;PID Curated;200065

Pathway

Class I PI3K signaling events mediated by Akt;PID Curated;200169

Pathway

roles of beta arrestin dependent recruitment of src kinases in gpcr signaling;PID BioCarta;100230

Pathway

p38MAPK events;PID Reactome;500627

Pathway

Signaling events mediated by PRL;PID Curated;200006

Pathway

Signaling by PDGF;Reactome;REACT:16888

Pathway

Recycling pathway of L1;PID Reactome;500098

Pathway

Membrane Trafficking;Reactome;REACT:11123

Pathway

cbl mediated ligand-induced downregulation of egf receptors pathway;PID BioCarta;100216

Pathway

CXCR3-mediated signaling events;PID Curated;200150

Pathway

cell to cell adhesion signaling;PID BioCarta;100208

Pathway

pelp1 modulation of estrogen receptor activity;PID BioCarta;100076

Pathway

ucalpain and friends in cell spread;PID BioCarta;100008

Pathway

Epithelial cell signaling in Helicobacter pylori infection;KEGG PATHWAY;hsa05120

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

Angiogenesis;PANTHER;P00005

Pathway

phospholipids as signalling intermediaries;PID BioCarta;100183

Pathway

c-src mediated regulation of Cx43 function and closure of gap junctions;PID Reactome;500026

Pathway

Gab1 signalosome;PID Reactome;500514

Pathway

Integrin alphaIIbbeta3 signaling;PID Reactome;500005

Pathway

role of nicotinic acetylcholine receptors in the regulation of apoptosis;PID BioCarta;100255

Pathway

amb2 Integrin signaling;PID Curated;200108

Pathway

agrin in postsynaptic differentiation;PID BioCarta;100252

Pathway

Cell junction organization;Reactome;REACT:20676

Pathway

Ephrin B reverse signaling;PID Curated;200173

Pathway

Alpha-synuclein signaling;PID Curated;200187

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

E-cadherin signaling in keratinocytes;PID Curated;200125

Pathway

Integrin cell surface interactions;Reactome;REACT:13552

Pathway

Class I PI3K signaling events;PID Curated;200098

Pathway

Trk receptor signaling mediated by PI3K and PLC-gamma;PID Curated;200183

Pathway

Nongenotropic Androgen signaling;PID Curated;200145

Pathway

Nectin adhesion pathway;PID Curated;200053

Pathway

Signaling by EGFR;PID Reactome;500510

Pathway

Netrin mediated repulsion signals;PID Reactome;500090

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

Regulation of Androgen receptor activity;PID Curated;200102

Pathway

gamma-aminobutyric acid receptor life cycle pathway;PID BioCarta;100158

Pathway

angiotensin ii mediated activation of jnk pathway via pyk2 dependent signaling;PID BioCarta;100236

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

NCAM signaling for neurite out-growth;PID Reactome;500079

Pathway

Hemostasis;Reactome;REACT:604

Pathway

erk and pi-3 kinase are necessary for collagen binding in corneal epithelia;PID BioCarta;100184

Pathway

FAS (CD95) signaling pathway;PID Curated;200067

Pathway

Down-stream signal transduction;PID Reactome;500509

Pathway

Internalization of ErbB1;PID Curated;200146

Pathway

vegf hypoxia and angiogenesis;PID BioCarta;100006

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Signaling events regulated by Ret tyrosine kinase;PID Curated;200058

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

calcium signaling by hbx of hepatitis b virus;PID BioCarta;100150

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

EGF receptor (ErbB1) signaling pathway;PID Curated;200085

Pathway

SHC-mediated cascade;PID Reactome;500250

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Pathway

Syndecan-2-mediated signaling events;PID Curated;200164

Pathway

Atypical NF-kappaB pathway;PID Curated;200017

Pathway

ErbB2/ErbB3 signaling events;PID Curated;200119

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

Parkinson disease;PANTHER;P00049

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Plasma membrane estrogen receptor signaling;PID Curated;200029

Pathway

links between pyk2 and map kinases;PID BioCarta;100057

Pathway

GnRH signaling pathway;KEGG PATHWAY;hsa04912

Pathway

Gap junction;KEGG PATHWAY;hsa04540

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

integrin signaling pathway;PID BioCarta;100123

Pathway

Arf6 signaling events;PID Curated;200060

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

Signaling by FGFR;Reactome;REACT:9470

Pathway

FGF signaling pathway;PID Curated;200189

Pathway

Netrin-mediated signaling;PID Curated;200074

Disease

Colon cancer, advanced;OMIM

External Links

Links to cell senescence gene database

6714

Links to epithelial mesenchymal transition gene database

6714

Links to ovarian cancer gene database

6714

Links to endometrial cancer gene database

6714

Links to iHOP

6714

Sequence Information

Nucleotide Sequence

>6714 : length: 4402
AGTGGGAGGCGGGGCTTCTGTGCCCGGTGTCCCCACCCCGCCCGGACCCCCAGCTCGGGC
CGCCCCTGGGTCTCTCCCGGGTCACCGGCGGGGAATCCGTCCCCGCGCGCTTCCTCCTTC
CTCCTCCTCCCGGCTGCCTGCCGGGCCCCTCCTCCCAGCTCGCGCGCTCCCTCCCTCCTC
TTCCCCTCCCCGGGCCGCCGCCGCCTCCTCCTCCTCCTCCTCCCTTTCTCTCTCGATCTG
TCTCTCCCGGCCCGGAATCCATTCCGGCCTGGGAGCCGGAGCGGCCAGGCCGCCGTCTGC
CCGTCCCGCTGGACGTCCCGCGGTCCGCCCTCCCGTGCGTCCGTCTGCCGGTGAGCCCGC
CCGCCCGCCGGCCCAGCCCCTGCGTCCTTCAGGTGGACTTAGGAGTGGACAGAGCCTGTG
TGTGCCCCTGGGCAAGACCTCCTGAACTTCATGGACTCTGTACAATTTGGGGCAGTGGTT
GCTGGGTCACCTGGGAACAGAGAACAGAAGCTCAGAGAAGTGAAGCAACTTGCCCAGCTA
TGAGAGACAGAGCCAGGATTTGAAACCAGATGAGGACGCTGAGGCCCAGAGAGGGAAAGC
CACTTGCCTAGGGACACACAGCGGGGAGAGGTGGAGCAGGGCCTCTATTTCGAGACCCCT
GACTCCACACCTGGTGTTTGTGCCAAGACCCCAGGCTGCCTCCCAGGTCCTCTGGGACAG
CCCCTGCCTTCTACCAGGACCATGGGTAGCAACAAGAGCAAGCCCAAGGATGCCAGCCAG
CGGCGCCGCAGCCTGGAGCCCGCCGAGAACGTGCACGGCGCTGGCGGGGGCGCTTTCCCC
GCCTCGCAGACCCCCAGCAAGCCAGCCTCGGCCGACGGCCACCGCGGCCCCAGCGCGGCC
TTCGCCCCCGCGGCCGCCGAGCCCAAGCTGTTCGGAGGCTTCAACTCCTCGGACACCGTC
ACCTCCCCGCAGAGGGCGGGCCCGCTGGCCGGTGGAGTGACCACCTTTGTGGCCCTCTAT
GACTATGAGTCTAGGACGGAGACAGACCTGTCCTTCAAGAAAGGCGAGCGGCTCCAGATT
GTCAACAACACAGAGGGAGACTGGTGGCTGGCCCACTCGCTCAGCACAGGACAGACAGGC
TACATCCCCAGCAACTACGTGGCGCCCTCCGACTCCATCCAGGCTGAGGAGTGGTATTTT
GGCAAGATCACCAGACGGGAGTCAGAGCGGTTACTGCTCAATGCAGAGAACCCGAGAGGG
ACCTTCCTCGTGCGAGAAAGTGAGACCACGAAAGGTGCCTACTGCCTCTCAGTGTCTGAC
TTCGACAACGCCAAGGGCCTCAACGTGAAGCACTACAAGATCCGCAAGCTGGACAGCGGC
GGCTTCTACATCACCTCCCGCACCCAGTTCAACAGCCTGCAGCAGCTGGTGGCCTACTAC
TCCAAACACGCCGATGGCCTGTGCCACCGCCTCACCACCGTGTGCCCCACGTCCAAGCCG
CAGACTCAGGGCCTGGCCAAGGATGCCTGGGAGATCCCTCGGGAGTCGCTGCGGCTGGAG
GTCAAGCTGGGCCAGGGCTGCTTTGGCGAGGTGTGGATGGGGACCTGGAACGGTACCACC
AGGGTGGCCATCAAAACCCTGAAGCCTGGCACGATGTCTCCAGAGGCCTTCCTGCAGGAG
GCCCAGGTCATGAAGAAGCTGAGGCATGAGAAGCTGGTGCAGTTGTATGCTGTGGTTTCA
GAGGAGCCCATTTACATCGTCACGGAGTACATGAGCAAGGGGAGTTTGCTGGACTTTCTC
AAGGGGGAGACAGGCAAGTACCTGCGGCTGCCTCAGCTGGTGGACATGGCTGCTCAGATC
GCCTCAGGCATGGCGTACGTGGAGCGGATGAACTACGTCCACCGGGACCTTCGTGCAGCC
AACATCCTGGTGGGAGAGAACCTGGTGTGCAAAGTGGCGGACTTTGGGCTGGCTCGGCTC
ATTGAAGACAATGAGTACACGGCGCGGCAAGGTGCCAAATTCCCCATCAAGTGGACGGCT
CCAGAAGCTGCCCTCTATGGCCGCTTCACCATCAAGTCGGACGTGTGGTCCTTCGGGATC
CTGCTGACTGAGCTCACCACAAAGGGACGGGTGCCCTACCCTGGGATGGTGAACCGCGAG
GTGCTGGACCAGGTGGAGCGGGGCTACCGGATGCCCTGCCCGCCGGAGTGTCCCGAGTCC
CTGCACGACCTCATGTGCCAGTGCTGGCGGAAGGAGCCTGAGGAGCGGCCCACCTTCGAG
TACCTGCAGGCCTTCCTGGAGGACTACTTCACGTCCACCGAGCCCCAGTACCAGCCCGGG
GAGAACCTCTAGGCACAGGCGGGCCCAGACCGGCTTCTCGGCTTGGATCCTGGGCTGGGT
GGCCCCTGTCTCGGGGCTTGCCCCACTCTGCCTGCCTGCTGTTGGTCCTCTCTCTGTGGG
GCTGAATTGCCAGGGGCGAGGCCCTTCCTCTTTGGTGGCATGGAAGGGGCTTCTGGACCT
AGGGTGGCCTGAGAGGGCGGTGGGTATGCGAGACCAGCACGGTGACTCTGTCCAGCTCCC
GCTGTGGCCGCACGCCTCTCCCTGCACTCCCTCCTGGAGCTCTGTGGGTCTCTGGAAGAG
GAACCAGGAGAAGGGCTGGGGCCGGGGCTGAGGGTGCCCTTTTCCAGCCTCAGCCTACTC
CGCTCACTGAACTCCTTCCCCACTTCTGTGCCACCCCCGGTCTATGTCGAGAGCTGGCCA
AAGAGCCTTTCCAAAGAGGAGCGATGGGCCCCTGGCCCCGCCTGCCTGCCACCCTGCCCC
TTGCCATCCATTCTGGAAACACCTGTAGGCAGAGGCTGCCGAGACAGACCCTCTGCCGCT
GCTTCCAGGCTGGGCAGCACAAGGCCTTGCCTGGCCTGATGATGGTGGGTGGGTGGGATG
AGTACCCCCTCAAACCCTGCCCTCCTTAGACCTGAGGGACCCTTCGAGATCATCACTTCC
TTGCCCCCATTTCACCCATGGGGAGACAGTTGAGAGCGGGGATGTGACATGCCCAAGGCC
ACGGAGCAGTTCAGAGTGGAGGCGGGCTTGGAACCCGGTGCTCCCTCTGTCATCCTCAGG
AACCAACAATTCGTCGGAGGCATCATGGAAAGACTGGGACAGCCCAGGAAACAAGGGGTC
TGAGGATGCATTCGAGATGGCAGATTCCCACTGCCGCTGCCCGCTCAGCCCAGCTGTTGG
GAACAGCATGGAGGCAGATGTGGGGCTGAGCTGGGGAATCAGGGTAAAAGGTGCAGGTGT
GGAGAGAGAGGCTTCAATCGGCTTGTGGGTGATGTTTGACCTTCAGAGCCAGCCGGCTAT
GAAAGGGAGCGAGCCCCTCGGCTCTGGAGGCAATCAAGCAGACATAGAAGAGCCAAGAGT
CCAGGAGGCCCTGGTCCTGGCCTCCTTCCCCGTACTTTGTCCCGTGGCATTTCAATTCCT
GGCCCTGTTCTCCTCCCCAAGTCGGCACCCTTTAACTCATGAGGAGGGAAAAGAGTGCCT
AAGCGGGGGTGAAAGAGGACGTGTTACCCACTGCCATGCACCAGGACTGGCTGTGTAACC
TTGGGTGGCCCCTGCTGTCTCTCTGGGCTGCAGAGTCTGCCCCACATGTGGCCATGGCCT
CTGCAACTGCTCAGCTCTGGTCCAGGCCCTGTGGCAGGACACACATGGTGAGCCTAGCCC
TGGGACATCAGGAGACTGGGCTCTGGCTCTGTTCGGCCTTTGGGTGTGTGGTGGATTCTC
CCTGGGCCTCAGTGTGCCCATCTGTAAAGGGGCAGCTGACAGTTTGTGGCATCTTGCCAA
GGGTCCCTGTGTGTGTGTATGTGTGTGCATGTGTGCGTGTCTCCATGTGCGTCCATATTT
AACATGTAAAAATGTCCCCCCCGCTCCGTCCCCCAAACATGTTGTACATTTCACCATGGC
CCCCTCATCATAGCAATAACATTCCCACTGCCAGGGGTTCTTGAGCCAGCCAGGCCCTGC
CAGTGGGGAAGGAGGCCAAGCAGTGCCTGCCTATGAAATTTCAACTTTTCCTTTCATACG
TCTTTATTACCCAAGTCTTCTCCCGTCCATTCCAGTCAAATCTGGGCTCACTCACCCCAG
CGAGCTCTCAAATCCCTCTCCAACTGCCTAAGGCCCTTTGTGTAAGGTGTCTTAATACTG
TCCTTTTTTTTTTTTTAACAGTGTTTTGTAGATTTCAGATGACTATGCAGAGGCCTGGGG
GACCCCTGGCTCTGGGCCGGGCCTGGGGCTCCGAAATTCCAAGGCCCAGACTTGCGGGGG
GTGGGGGGGTATCCAGAATTGGTTGTAAATACTTTGCATATTGTCTGATTAAACACAAAC
AGACCTCAGAATCTGATCAACA

Protein Sequence

>6714 : length: 536
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL