ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6688

Name

SPI1

Synonym

OF|PU.1|SFPI1|SPI-1|SPI-A;Spi-1 proto-oncogene;SPI1;Spi-1 proto-oncogene

Definition

31 kDa transforming protein|31 kDa-transforming protein|hematopoietic transcription factor PU.1|spleen focus forming virus (SFFV) proviral integration oncogene spi1|transcription factor PU.1

Position

11p11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Regulation of retinoblastoma protein;PID Curated;200191

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

Glucocorticoid receptor regulatory network;PID Curated;200077

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

Acute myeloid leukemia (AML);KEGG DISEASE;H00003

Disease

Leukoencephalopathy;FunDO

Disease

Cancers;KEGG DISEASE

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Lymphoma;FunDO

External Links

Links to cell senescence gene database

6688

Links to epithelial mesenchymal transition gene database

6688

Links to ovarian cancer gene database

6688

Links to endometrial cancer gene database

6688

Links to iHOP

6688

Sequence Information

Nucleotide Sequence

>6688 : length: 3023
ATTTATTATAGCCATGAAATGCTCTGCTCTCTTCTCTTTTCCTTGCTGTCCCTGGGGCTG
GAGGAGCACGGGCCTCCCCGGGAGTGGGCTTCAGCCTCCCTAGACTCCTGTCTCCTTCCA
AGGGCTAGGCCTGGGGGACCAGAAGCAAGAGTCCCTAGAGCGTCCAAGATTTTTGGTTTC
AAACCAATTTCCTGCTGACCAGAATGAAATGGAGCCACATTCCAGCACGATGCACCTGCT
GACCTCCTGCAAGTCAGGGACCTTCTCTGCCCCTCTTTTGCTCTGCTGCAGGAGGGAGAA
GCTGGGAATGTGTTCCTCTGGGGTCCCATCACCTCCAGCCAGCCACTGTCCCTGTCTCCC
CAAAACCTCCTCGTTGTCCCTCCTCTGTCCTCCTCCTCCTCCATCTGCCTTCGCCCTGCT
CTCCTCTTTTTCGCCTGAGGTTCGTGCTGCCTCCTCACCTCTTGTCCTGTTTCTCCCTTC
TCTCTGCTCCCTCCTTTGATCTTGCTATTTTGCTTCTCTTTCCCTTCCTCTCTTCTCCTC
CCTCCCCTTCCTCCCTGCTCCCTGCCTCAGCTTCTCAGTCTCTCTCCGTTCTTCCTCTAG
CTTCCTTCCCTCCCCAGAAGACCCAGCCCTTCCTAGAGCCCCAGAAGCCAGGGTTCATGC
CCCAGCTCTCTACCCACACATGCTGTGCAACCCTGGGCCAGTCACTGGTCTCTTGGGCCT
CAGTTCAACAGATGGCTGTCTTGGTGATGTGAGATCATAGGGTGGAAGCACCCAGAATGG
TGCCAGGCACTCAAAAATTTTTTTCTTTTCCTTTTTAAGGAACTACTAACCGTGAGGTTA
TGGATTACCAAACCGTTCCTGTTCTTGGAATCTGGGTCCTACTATTCCCAAGAATTTGAA
TTACCACGGGTCCCTGGGGATGTAAGGGGATGAGGCTTCTGATGTACTTTGGGAGGGGGA
GGAGTGGAAAGAGGAGTTGGGAGGACACTCTAGCATTGCCCAGAGGGCAGAGGACATTCT
GCCTATTTCCAGAGGTTATTGACCCTGGATCTCTTTTATGGAGTTCCTCACCCAGGCCCC
TTGAGCTTGGCCATACTTGAGGCAATGGGATATCTTCCTTCTCCTGGAGCCCCTTGAATC
TTAGGCCTCGGGAACACACAGTCTACTGTGTTTCTTGGCTGCACCCACGGAGGACAGCCC
CCATACTCCTTGCTTACAACCAGCAAAGACTCCACAGCCATCCCTGCACACGACTCAGGC
TCCTTGGCTTGGCACTCAAGGCTCTTTGCTTTCCTGTCCTGCTTTGCTTCCAGCTGCAAA
GATGGTGGCTTCCTGTTTTCCTCTTCGTTTCCTTTGCTTAAGTTGATTCTCAGCCAGACA
TGCTTTCCCCCTGCACGCTTCCCTAAGCCATCCTATCTGGGACCCTGACCCAATCAATGG
TTCCCTAATGCACCTTTGAGACCAAGTGTACCTGGCACCTCCTCTCTTGCCCCACTATCT
GCTCACATGACCCTCTGCAGGCCTGTAAGCTGCTGGAGGCTCCGAGTATGCCTCATTCAT
GTCTATCCCCCTTACTAGGCCCAGACCATGGAAGACACTCAATAAAAACAGAGGGGACTC
ACCAGAGATCACTGGGCCAGAAAAACAACAACAACAACAACAACAACAAAACAAAAATGC
CTCTACTCATCCCTCCACCCCCCAGAAAAGATCAGGAACTCTCTGAAGCACTATTCATAA
TAGCAAAGATACAGAATCAACATAAGTGTCCATCAACGGCAACATGGATGGAATTGGAGG
ACATTATCATATGCGAAACAACGCAGAAACAGAAAGTCAAATACTGCCTGTTCTCATGGG
GCTCCTGGAAACCGAAGCTGATAGCAGCCATCAGAAGACCTGGTGCCCTATGACACGGAT
CTATACCAACGCCAAACGCACGAGTATTACCCCTATCTCAGCAGTGATGGGGAGAGCCAT
AGCGACCATTACTGGGACTTCCACCCCCACCACGTGCACAGCGAGTTCGAGAGCTTCGCC
GAGAACAACTTCACGGAGCTCCAGAGCGTGCAGCCCCCGCAGCTGCAGCAGCTCTACCGC
CACATGGAGCTGGAGCAGATGCACGTCCTCGATACCCCCATGGTGCCACCCCATCCCAGT
CTTGGCCACCAGGTCTCCTACCTGCCCCGGATGTGCCTCCAGTACCCATCCCTGTCCCCA
GCCCAGCCCAGCTCAGATGAGGAGGAGGGCGAGCGGCAGAGCCCCCCACTGGAGGTGTCT
GACGGCGAGGCGGATGGCCTGGAGCCCGGGCCTGGGCTCCTGCCTGGGGAGACAGGCAGC
AAGAAGAAGATCCGCCTGTACCAGTTCCTGTTGGACCTGCTCCGCAGCGGCGACATGAAG
GACAGCATCTGGTGGGTGGACAAGGACAAGGGCACCTTCCAGTTCTCGTCCAAGCACAAG
GAGGCGCTGGCGCACCGCTGGGGCATCCAGAAGGGCAACCGCAAGAAGATGACCTACCAG
AAGATGGCGCGCGCGCTGCGCAACTACGGCAAGACGGGCGAGGTCAAGAAGGTGAAGAAG
AAGCTCACCTACCAGTTCAGCGGCGAAGTGCTGGGCCGCGGGGGCCTGGCCGAGCGGCGC
CACCCGCCCCACTGAGCCCGCAGCCCCCGCCGGGCCCCGCCAGGCCTCCCCGCTGGCCAT
AGCATTAAGCCCTCGCCCGGCCCGGACACAGGGAGGACGCTCCCGGGGCCCAGAGGCAGG
ACTGTGGCGGGCCGGGCCTCGCCTCACCCGCCCCCTCCCCCCACTCCAGGCCCCCTCCAC
ATCCCGCTTCGCCTCCCTCCAGGACTCCACCCCGGCTCCCGGACGCCAGCTGGGCGTCAG
ACCCCACCGGGGCAACCTTGCAGAGGACGACCCGGGGTACTGCCTTGGGAGTCTCAAGTC
CGTATGTAAATCAGATCTCCCCTCTCACCCCTCCCACCCATTAACCTCCTCCCAAAAAAC
AAGTAAAGTTATTCTCAATCCAT

Protein Sequence

>6688 : length: 271
MLQACKMEGFPLVPPQPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVH
SEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCL
QYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDL
LRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTG
EVKKVKKKLTYQFSGEVLGRGGLAERRHPPH