ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6678

Name

SPARC

Synonym

ON;secreted protein, acidic, cysteine-rich (osteonectin);SPARC;secreted protein, acidic, cysteine-rich (osteonectin)

Definition

BM-40|basement-membrane protein 40|cysteine-rich protein|osteonectin|secreted protein acidic and rich in cysteine

Position

5q31.3-q32

Gene Type

protein-coding

Pathways and Diseases

Pathway

Hemostasis;Reactome;REACT:604

Disease

Alveolar bone loss;FunDO

Disease

IMMUNE;GAD

Disease

Cancer;FunDO

Disease

Gingival overgrowth;FunDO

Disease

scleroderma;GAD

External Links

Links to cell senescence gene database

6678

Links to epithelial mesenchymal transition gene database

6678

Links to ovarian cancer gene database

6678

Links to endometrial cancer gene database

6678

Links to iHOP

6678

Sequence Information

Nucleotide Sequence

>6678 : length: 3604
GGGAGAAGGAGGAGGCCGGGGGAAGGAGGAGACAGGAGGAGGAGGGACCACGGGGTGGAG
GGGAGATAGACCCAGCCCAGAGCTCTGAGTGGTTTCCTGTTGCCTGTCTCTAAACCCCTC
CACATTCCCGCGGTCCTTCAGACTGCCCGGAGAGCGCGCTCTGCCTGCCGCCTGCCTGCC
TGCCACTGAGGGTTCCCAGCACCATGAGGGCCTGGATCTTCTTTCTCCTTTGCCTGGCCG
GGAGGGCCTTGGCAGCCCCTCAGCAAGAAGCCCTGCCTGATGAGACAGAGGTGGTGGAAG
AAACTGTGGCAGAGGTGACTGAGGTATCTGTGGGAGCTAATCCTGTCCAGGTGGAAGTAG
GAGAATTTGATGATGGTGCAGAGGAAACCGAAGAGGAGGTGGTGGCGGAAAATCCCTGCC
AGAACCACCACTGCAAACACGGCAAGGTGTGCGAGCTGGATGAGAACAACACCCCCATGT
GCGTGTGCCAGGACCCCACCAGCTGCCCAGCCCCCATTGGCGAGTTTGAGAAGGTGTGCA
GCAATGACAACAAGACCTTCGACTCTTCCTGCCACTTCTTTGCCACAAAGTGCACCCTGG
AGGGCACCAAGAAGGGCCACAAGCTCCACCTGGACTACATCGGGCCTTGCAAATACATCC
CCCCTTGCCTGGACTCTGAGCTGACCGAATTCCCCCTGCGCATGCGGGACTGGCTCAAGA
ACGTCCTGGTCACCCTGTATGAGAGGGATGAGGACAACAACCTTCTGACTGAGAAGCAGA
AGCTGCGGGTGAAGAAGATCCATGAGAATGAGAAGCGCCTGGAGGCAGGAGACCACCCCG
TGGAGCTGCTGGCCCGGGACTTCGAGAAGAACTATAACATGTACATCTTCCCTGTACACT
GGCAGTTCGGCCAGCTGGACCAGCACCCCATTGACGGGTACCTCTCCCACACCGAGCTGG
CTCCACTGCGTGCTCCCCTCATCCCCATGGAGCATTGCACCACCCGCTTTTTCGAGACCT
GTGACCTGGACAATGACAAGTACATCGCCCTGGATGAGTGGGCCGGCTGCTTCGGCATCA
AGCAGAAGGATATCGACAAGGATCTTGTGATCTAAATCCACTCCTTCCACAGTACCGGAT
TCTCTCTTTAACCCTCCCCTTCGTGTTTCCCCCAATGTTTAAAATGTTTGGATGGTTTGT
TGTTCTGCCTGGAGACAAGGTGCTAACATAGATTTAAGTGAATACATTAACGGTGCTAAA
AATGAAAATTCTAACCCAAGACATGACATTCTTAGCTGTAACTTAACTATTAAGGCCTTT
TCCACACGCATTAATAGTCCCATTTTTCTCTTGCCATTTGTAGCTTTGCCCATTGTCTTA
TTGGCACATGGGTGGACACGGATCTGCTGGGCTCTGCCTTAAACACACATTGCAGCTTCA
ACTTTTCTCTTTAGTGTTCTGTTTGAAACTAATACTTACCGAGTCAGACTTTGTGTTCAT
TTCATTTCAGGGTCTTGGCTGCCTGTGGGCTTCCCCAGGTGGCCTGGAGGTGGGCAAAGG
GAAGTAACAGACACACGATGTTGTCAAGGATGGTTTTGGGACTAGAGGCTCAGTGGTGGG
AGAGATCCCTGCAGAACCCACCAACCAGAACGTGGTTTGCCTGAGGCTGTAACTGAGAGA
AAGATTCTGGGGCTGTGTTATGAAAATATAGACATTCTCACATAAGCCCAGTTCATCACC
ATTTCCTCCTTTACCTTTCAGTGCAGTTTCTTTTCACATTAGGCTGTTGGTTCAAACTTT
TGGGAGCACGGACTGTCAGTTCTCTGGGAAGTGGTCAGCGCATCCTGCAGGGCTTCTCCT
CCTCTGTCTTTTGGAGAACCAGGGCTCTTCTCAGGGGCTCTAGGGACTGCCAGGCTGTTT
CAGCCAGGAAGGCCAAAATCAAGAGTGAGATGTAGAAAGTTGTAAAATAGAAAAAGTGGA
GTTGGTGAATCGGTTGTTCTTTCCTCACATTTGGATGATTGTCATAAGGTTTTTAGCATG
TTCCTCCTTTTCTTCACCCTCCCCTTTTTTCTTCTATTAATCAAGAGAAACTTCAAAGTT
AATGGGATGGTCGGATCTCACAGGCTGAGAACTCGTTCACCTCCAAGCATTTCATGAAAA
AGCTGCTTCTTATTAATCATACAAACTCTCACCATGATGTGAAGAGTTTCACAAATCCTT
CAAAATAAAAAGTAATGACTTAGAAACTGCCTTCCTGGGTGATTTGCATGTGTCTTAGTC
TTAGTCACCTTATTATCCTGACACAAAAACACATGAGCATACATGTCTACACATGACTAC
ACAAATGCAAACCTTTGCAAACACATTATGCTTTTGCACACACACACCTGTACACACACA
CCGGCATGTTTATACACAGGGAGTGTATGGTTCCTGTAAGCACTAAGTTAGCTGTTTTCA
TTTAATGACCTGTGGTTTAACCCTTTTGATCACTACCACCATTATCAGCACCAGACTGAG
CAGCTATATCCTTTTATTAATCATGGTCATTCATTCATTCATTCATTCACAAAATATTTA
TGATGTATTTACTCTGCACCAGGTCCCATGCCAAGCACTGGGGACACAGTTATGGCAAAG
TAGACAAAGCATTTGTTCATTTGGAGCTTAGAGTCCAGGAGGAATACATTAGATAATGAC
ACAATCAAATATAAATTGCAAGATGTCACAGGTGTGATGAAGGGAGAGTAGGAGAGACCA
TGAGTATGTGTAACAGGAGGACACAGCATTATTCTAGTGCTGTACTGTTCCGTACGGCAG
CCACTACCCACATGTAACTTTTTAAGATTTAAATTTAAATTAGTTAACATTCAAAACGCA
GCTCCCCAATCACACTAGCAACATTTCAAGTGCTTGAGAGCCATGCATGATTAGTGGTTA
CCCTATTGAATAGGTCAGAAGTAGAATCTTTTCATCATCACAGAAAGTTCTATTGGACAG
TGCTCTTCTAGATCATCATAAGACTACAGAGCACTTTTCAAAGCTCATGCATGTTCATCA
TGTTAGTGTCGTATTTTGAGCTGGGGTTTTGAGACTCCCCTTAGAGATAGAGAAACAGAC
CCAAGAAATGTGCTCAATTGCAATGGGCCACATACCTAGATCTCCAGATGTCATTTCCCC
TCTCTTATTTTAAGTTATGTTAAGATTACTAAAACAATAAAAGCTCCTAAAAAATCAAAC
TGTATTCTGGTGTTCTCTTCTACACAGTGGGAGGGCGAGCAGTAGGAGAGATTGGCCCAT
TTGGTGCTGGCCATTTGAGGAATGCAAGCCCAGCACTAGTCTCATAATCTCTAGGAATCT
GTAGAGAGAGGAATTGAAGTAAATTTCAGCATTGGCTCATTCAGTCATTCGGCGACATTC
ATCAGGTACCTGCAATGTGTTAGGGGATCTTATGAGTAGGCAGCGTGCGTGATCCTTGCT
CCCCTGGAGCTTTCTAACATTCTAGCAGGCAGACCACACATAAATTTGCAATACTGTTTC
TGATAAAAACGTGCTGTAAAGGAAATAAAGCAGAGAACTATCATGGAAAAAAAAAAAAAA
AAAA

Protein Sequence

>6678 : length: 303
MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAE
ETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFD
SSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYE
RDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQ
HPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKD
LVI