ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6659

Name

SOX4

Synonym

EVI16;SRY (sex determining region Y)-box 4;SOX4;SRY (sex determining region Y)-box 4

Definition

SRY-related HMG-box gene 4|ecotropic viral integration site 16|transcription factor SOX-4

Position

6p22.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

6659

Links to epithelial mesenchymal transition gene database

6659

Links to ovarian cancer gene database

6659

Links to endometrial cancer gene database

6659

Links to iHOP

6659

Sequence Information

Nucleotide Sequence

>6659 : length: 4912
ATTGGGGTCTGCTCTAAGCTGCAGCAAGAGAAACTGTGTGTGAGGGGAAGAGGCCTGTTT
CGCTGTCGGGTCTCTAGTTCTTGCACGCTCTTTAAGAGTCTGCACTGGAGGAACTCCTGC
CATTACCAGCTCCCTTCTTGCAGAAGGGAGGGGGAAACATACATTTATTCATGCCAGTCT
GTTGCATGCAGGCTTTTTGGCTTCCTACCTTGCAACAAAATAATTGCACCAACTCCTTAG
TGCCGATTCCGCCCACAGAGAGTCCTGGAGCCACAGTCTTTTTTGCTTTGCATTGTAGGA
GAGGGACTAAGTGCTAGAGACTATGTCGCTTTCCTGAGCTACCGAGAGCGCTCGTGAACT
GGAATCAACTGCTTCAGGGAAAAAGAAAAAAAAAAAAAAAAGACTTGCCTGGGAGGCCGC
GAGAAACTTGCATTGGAAGCTTCAGCAACCAGCATTCGAGAAACTCCTCTCTACTTTAGC
ACGGTCTCCAGACTCAGCCGAGAGACAGCAAACTGCAGCGCGGTGAGAGAGCGAGAGAGA
GGGAGAGAGAGACTCTCCAGCCTGGGAACTATAACTCCTCTGCGAGAGGCGGAGAACTCC
TTCCCCAAATCTTTTGGGGACTTTTCTCTCTTTACCCACCTCCGCCCCTGCGAGGAGTTG
AGGGGCCAGTTCGGCCGCCGCGCGCGTCTTCCCGTTCGGCGTGTGCTTGGCCCGGGGAAC
CGGGAGGGCCCGGCGATCGCGCGGCGGCCGCCGCGAGGGTGTGAGCGCGCGTGGGCGCCC
GCCGAGCCGAGGCCATGGTGCAGCAAACCAACAATGCCGAGAACACGGAAGCGCTGCTGG
CCGGCGAGAGCTCGGACTCGGGCGCCGGCCTCGAGCTGGGAATCGCCTCCTCCCCCACGC
CCGGCTCCACCGCCTCCACGGGCGGCAAGGCCGACGACCCGAGCTGGTGCAAGACCCCGA
GTGGGCACATCAAGCGACCCATGAACGCCTTCATGGTGTGGTCGCAGATCGAGCGGCGCA
AGATCATGGAGCAGTCGCCCGACATGCACAACGCCGAGATCTCCAAGCGGCTGGGCAAAC
GCTGGAAGCTGCTCAAAGACAGCGACAAGATCCCTTTCATTCGAGAGGCGGAGCGGCTGC
GCCTCAAGCACATGGCTGACTACCCCGACTACAAGTACCGGCCCAGGAAGAAGGTGAAGT
CCGGCAACGCCAACTCCAGCTCCTCGGCCGCCGCCTCCTCCAAGCCGGGGGAGAAGGGAG
ACAAGGTCGGTGGCAGTGGCGGGGGCGGCCATGGGGGCGGCGGCGGCGGCGGGAGCAGCA
ACGCGGGGGGAGGAGGCGGCGGTGCGAGTGGCGGCGGCGCCAACTCCAAACCGGCGCAGA
AAAAGAGCTGCGGCTCCAAAGTGGCGGGCGGCGCGGGCGGTGGGGTTAGCAAACCGCACG
CCAAGCTCATCCTGGCAGGCGGCGGCGGCGGCGGGAAAGCAGCGGCTGCCGCCGCCGCCT
CCTTCGCCGCCGAACAGGCGGGGGCCGCCGCCCTGCTGCCCCTGGGCGCCGCCGCCGACC
ACCACTCGCTGTACAAGGCGCGGACTCCCAGCGCCTCGGCCTCCGCCTCCTCGGCAGCCT
CGGCCTCCGCAGCGCTCGCGGCCCCGGGCAAGCACCTGGCGGAGAAGAAGGTGAAGCGCG
TCTACCTGTTCGGCGGCCTGGGCACGTCGTCGTCGCCCGTGGGCGGCGTGGGCGCGGGAG
CCGACCCCAGCGACCCCCTGGGCCTGTACGAGGAGGAGGGCGCGGGCTGCTCGCCCGACG
CGCCCAGCCTGAGCGGCCGCAGCAGCGCCGCCTCGTCCCCCGCCGCCGGCCGCTCGCCCG
CCGACCACCGCGGCTACGCCAGCCTGCGCGCCGCCTCGCCCGCCCCGTCCAGCGCGCCCT
CGCACGCGTCCTCCTCGGCCTCGTCCCACTCCTCCTCTTCCTCCTCCTCGGGCTCCTCGT
CCTCCGACGACGAGTTCGAAGACGACCTGCTCGACCTGAACCCCAGCTCAAACTTTGAGA
GCATGTCCCTGGGCAGCTTCAGTTCGTCGTCGGCGCTCGACCGGGACCTGGATTTTAACT
TCGAGCCCGGCTCCGGCTCGCACTTCGAGTTCCCGGACTACTGCACGCCCGAGGTGAGCG
AGATGATCTCGGGAGACTGGCTCGAGTCCAGCATCTCCAACCTGGTTTTCACCTACTGAA
GGGCGCGCAGGCAGGGAGAAGGGCCGGGGGGGGTAGGAGAGGAGAAAAAAAAAGTGAAAA
AAAGAAACGAAAAGGACAGACGAAGAGTTTAAAGAGAAAAGGGAAAAAAGAAAGAAAAAG
TAAGCAGGGCTGGCTTCGCCCGCGTTCTCGTCGTCGGATCAAGGAGCGCGGCGGCGTTTT
GGACCCGCGCTCCCATCCCCCACCTTCCCGGGCCGGGGACCCACTCTGCCCAGCCGGAGG
GACGCGGAGGAGGAAGAGGGTAGACAGGGGCGACCTGTGATTGTTGTTATTGATGTTGTT
GTTGATGGCAAAAAAAAAAAAGCGACTTCGAGTTTGCTCCCCTTTGCTTGAAGAGACCCC
CTCCCCCTTCCAACGAGCTTCCGGACTTGTCTGCACCCCCAGCAAGAAGGCGAGTTAGTT
TTCTAGAGACTTGAAGGAGTCTCCCCCTTCCTGCATCACCACCTTGGTTTTGTTTTATTT
TGCTTCTTGGTCAAGAAAGGAGGGGAGAACCCAGCGCACCCCTCCCCCCCTTTTTTTAAA
CGCGTGATGAAGACAGAAGGCTCCGGGGTGACGAATTTGGCCGATGGCAGATGTTTTGGG
GGAACGCCGGGACTGAGAGACTCCACGCAGGCGAATTCCCGTTTGGGGCTTTTTTTTCCT
CCCTCTTTTCCCCTTGCCCCCTCTGCAGCCGGAGGAGGAGATGTTGAGGGGAGGAGGCCA
GCCAGTGTGACCGGCGCTAGGAAATGACCCGAGAACCCCGTTGGAAGCGCAGCAGCGGGA
GCTAGGGGCGGGGGCGGAGGAGGACACGAACTGGAAGGGGGTTCACGGTCAAACTGAAAT
GGATTTGCACGTTGGGGAGCTGGCGGCGGCGGCTGCTGGGCCTCCGCCTTCTTTTCTACG
TGAAATCAGTGAGGTGAGACTTCCCAGACCCCGGAGGCGTGGAGGAGAGGAGACTGTTTG
ATGTGGTACAGGGGCAGTCAGTGGAGGGCGAGTGGTTTCGGAAAAAAAAAAAGAAAAAAA
GAAAAAAAAAGAAAAAAAAAAGATTTTTTTCTTCTCTTAATCGGAATCGTGATGGTGTTG
GATTATTTCAATGGTGGGGTTAATATAGCATGTTATCCTGTCTATCTTTTAAAGATTTCT
GTATAAGACTGTTGAGCAGTTTTTAAAATAGTGTAGGATAATATAAAAAGCAGATAGATG
GCGCTATGTTTGATTCCTACAACGAAATTATCACCAGCTTTTTTTCATTCTTAACTCTTT
AAAGGATTCAAACGCAACTCAAATCTGTGCTGGACTTTAAAAAAACAATTCAGGACCAAA
TTTTTTCTCAGTGTGTGTGTTTATTCCTTATAGGTGTAAATGAGAAGACGTGTTTTTTTC
CTTCACCGATGCTCCATCCTCGTATTTCTTTTTCCTTGTAAATGTAATCAGATGCCATTT
TATATGTGGACGTATTTATACTGGCCAAACATATTTTTTCTTTTGTCCCTTTTTTTCTTT
CCTTTCTTTTTACTTCCTTTATTTCTTTATTCCTTCCTTTTCCTTTTTTTCTTTTTTTTT
TCTTTTTTTTTTTTTTTTTTTGGTAGTTGTTGTTACCCACGCCATTTTACGTCTCCTTCA
CTGAAGGGCTAGAGTTTTAACTTTTAATTTTTTATATTTAAATGTAGACTTTTGACACTT
TTAAAAAACAAAAAAAGACAAGAGAGATGAAAACGTTTGATTATTTTCTCAGTGTATTTT
TGTAAAAAATATATAAAGGGGGTGTTAATCGGTGTAAATCGCTGTTTGGATTTCCTGATT
TTATAACAGGGCGGCTGGTTAATATCTCACACAGTTTAAAAAATCAGCCCCTAATTTCTC
CATGTTTACACTTCAATCTGCAGGCTTCTTAAAGTGACAGTATCCCTTAACCTGCCACCA
GTGTCCACCCTCCGGCCCCCGTCTTGTAAAAAGGGGAGGAGAATTAGCCAAACACTGTAA
GCTTTTAAGAAAAACAAAGTTTTAAACGAAATACTGCTCTGTCCAGAGGCTTTAAAACTG
GTGCAATTACAGCAAAAAGGGATTCTGTAGCTTTAACTTGTAAACCACATCTTTTTTGCA
CTTTTTTTATAAGCAAAAACGTGCCGTTTAAACCACTGGATCTATCTAAATGCCGATTTG
AGTTCGCGACACTATGTACTGCGTTTTTCATTCTTGTATTTGACTATTTAATCCTTTCTA
CTTGTCGCTAAATATAATTGTTTTAGTCTTATGGCATGATGATAGCATATGTGTTCAGGT
TTATAGCTGTTGTGTTTAAAAATTGAAAAAAGTGGAAAACATCTTTGTACATTTAAGTCT
GTATTATAATAAGCAAAAAGATTGTGTGTATGTATGTTTAATATAACATGACAGGCACTA
GGACGTCTGCCTTTTTAAGGCAGTTCCGTTAAGGGTTTTTGTTTTTAAACTTTTTTTTGC
CATCCATCCTGTGCAATATGCCGTGTAGAATATTTGTCTTAAAATTCAAGGCCACAAAAA
CAATGTTTGGGGGAAAAAAAAGAAAAAATCATGCCAGCTAATCATGTCAAGTTCACTGCC
TGTCAGATTGTTGATATATACCTTCTGTAAATAACTTTTTTTGAGAAGGAAATAAAATCA
GCTGGAACTGAACCCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>6659 : length: 474
MVQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGGKADDPSWCKTPSGHIK
RPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHM
ADYPDYKYRPRKKVKSGNANSSSSAAASSKPGEKGDKVGGSGGGGHGGGGGGGSSNAGGG
GGGASGGGANSKPAQKKSCGSKVAGGAGGGVSKPHAKLILAGGGGGGKAAAAAAASFAAE
QAGAAALLPLGAAADHHSLYKARTPSASASASSAASASAALAAPGKHLAEKKVKRVYLFG
GLGTSSSPVGGVGAGADPSDPLGLYEEEGAGCSPDAPSLSGRSSAASSPAAGRSPADHRG
YASLRAASPAPSSAPSHASSSASSHSSSSSSSGSSSSDDEFEDDLLDLNPSSNFESMSLG
SFSSSSALDRDLDFNFEPGSGSHFEFPDYCTPEVSEMISGDWLESSISNLVFTY