ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6657

Name

SOX2

Synonym

ANOP3|MCOPS3;SRY (sex determining region Y)-box 2;SOX2;SRY (sex determining region Y)-box 2

Definition

SRY-related HMG-box gene 2|transcription factor SOX-2|transcription factor SOX2

Position

3q26.3-q27

Gene Type

protein-coding

External Links

Links to cell senescence gene database

6657

Links to epithelial mesenchymal transition gene database

6657

Links to ovarian cancer gene database

6657

Links to endometrial cancer gene database

6657

Links to iHOP

6657

Sequence Information

Nucleotide Sequence

>6657 : length: 2520
GGATGGTTGTCTATTAACTTGTTCAAAAAAGTATCAGGAGTTGTCAAGGCAGAGAAGAGA
GTGTTTGCAAAAGGGGGAAAGTAGTTTGCTGCCTCTTTAAGACTAGGACTGAGAGAAAGA
AGAGGAGAGAGAAAGAAAGGGAGAGAAGTTTGAGCCCCAGGCTTAAGCCTTTCCAAAAAA
TAATAATAACAATCATCGGCGGCGGCAGGATCGGCCAGAGGAGGAGGGAAGCGCTTTTTT
TGATCCTGATTCCAGTTTGCCTCTCTCTTTTTTTCCCCCAAATTATTCTTCGCCTGATTT
TCCTCGCGGAGCCCTGCGCTCCCGACACCCCCGCCCGCCTCCCCTCCTCCTCTCCCCCCG
CCCGCGGGCCCCCCAAAGTCCCGGCCGGGCCGAGGGTCGGCGGCCGCCGGCGGGCCGGGC
CCGCGCACAGCGCCCGCATGTACAACATGATGGAGACGGAGCTGAAGCCGCCGGGCCCGC
AGCAAACTTCGGGGGGCGGCGGCGGCAACTCCACCGCGGCGGCGGCCGGCGGCAACCAGA
AAAACAGCCCGGACCGCGTCAAGCGGCCCATGAATGCCTTCATGGTGTGGTCCCGCGGGC
AGCGGCGCAAGATGGCCCAGGAGAACCCCAAGATGCACAACTCGGAGATCAGCAAGCGCC
TGGGCGCCGAGTGGAAACTTTTGTCGGAGACGGAGAAGCGGCCGTTCATCGACGAGGCTA
AGCGGCTGCGAGCGCTGCACATGAAGGAGCACCCGGATTATAAATACCGGCCCCGGCGGA
AAACCAAGACGCTCATGAAGAAGGATAAGTACACGCTGCCCGGCGGGCTGCTGGCCCCCG
GCGGCAATAGCATGGCGAGCGGGGTCGGGGTGGGCGCCGGCCTGGGCGCGGGCGTGAACC
AGCGCATGGACAGTTACGCGCACATGAACGGCTGGAGCAACGGCAGCTACAGCATGATGC
AGGACCAGCTGGGCTACCCGCAGCACCCGGGCCTCAATGCGCACGGCGCAGCGCAGATGC
AGCCCATGCACCGCTACGACGTGAGCGCCCTGCAGTACAACTCCATGACCAGCTCGCAGA
CCTACATGAACGGCTCGCCCACCTACAGCATGTCCTACTCGCAGCAGGGCACCCCTGGCA
TGGCTCTTGGCTCCATGGGTTCGGTGGTCAAGTCCGAGGCCAGCTCCAGCCCCCCTGTGG
TTACCTCTTCCTCCCACTCCAGGGCGCCCTGCCAGGCCGGGGACCTCCGGGACATGATCA
GCATGTATCTCCCCGGCGCCGAGGTGCCGGAACCCGCCGCCCCCAGCAGACTTCACATGT
CCCAGCACTACCAGAGCGGCCCGGTGCCCGGCACGGCCATTAACGGCACACTGCCCCTCT
CACACATGTGAGGGCCGGACAGCGAACTGGAGGGGGGAGAAATTTTCAAAGAAAAACGAG
GGAAATGGGAGGGGTGCAAAAGAGGAGAGTAAGAAACAGCATGGAGAAAACCCGGTACGC
TCAAAAAGAAAAAGGAAAAAAAAAAATCCCATCACCCACAGCAAATGACAGCTGCAAAAG
AGAACACCAATCCCATCCACACTCACGCAAAAACCGCGATGCCGACAAGAAAACTTTTAT
GAGAGAGATCCTGGACTTCTTTTTGGGGGACTATTTTTGTACAGAGAAAACCTGGGGAGG
GTGGGGAGGGCGGGGGAATGGACCTTGTATAGATCTGGAGGAAAGAAAGCTACGAAAAAC
TTTTTAAAAGTTCTAGTGGTACGGTAGGAGCTTTGCAGGAAGTTTGCAAAAGTCTTTACC
AATAATATTTAGAGCTAGTCTCCAAGCGACGAAAAAAATGTTTTAATATTTGCAAGCAAC
TTTTGTACAGTATTTATCGAGATAAACATGGCAATCAAAATGTCCATTGTTTATAAGCTG
AGAATTTGCCAATATTTTTCAAGGAGAGGCTTCTTGCTGAATTTTGATTCTGCAGCTGAA
ATTTAGGACAGTTGCAAACGTGAAAAGAAGAAAATTATTCAAATTTGGACATTTTAATTG
TTTAAAAATTGTACAAAAGGAAAAAATTAGAATAAGTACTGGCGAACCATCTCTGTGGTC
TTGTTTAAAAAGGGCAAAAGTTTTAGACTGTACTAAATTTTATAACTTACTGTTAAAAGC
AAAAATGGCCATGCAGGTTGACACCGTTGGTAATTTATAATAGCTTTTGTTCGATCCCAA
CTTTCCATTTTGTTCAGATAAAAAAAACCATGAAATTACTGTGTTTGAAATATTTTCTTA
TGGTTTGTAATATTTCTGTAAATTTATTGTGATATTTTAAGGTTTTCCCCCCTTTATTTT
CCGTAGTTGTATTTTAAAAGATTCGGCTCTGTATTATTTGAATCAGTCTGCCGAGAATCC
ATGTATATATTTGAACTAATATCATCCTTATAACAGGTACATTTTCAACTTAAGTTTTTA
CTCCATTATGCACAGTTTGAGATAAATAAATTTTTGAAATATGGACACTGAAAAAAAAAA

Protein Sequence

>6657 : length: 317
MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMA
QENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLM
KKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGY
PQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM
GSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQS
GPVPGTAINGTLPLSHM