ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6623

Name

SNCG

Synonym

BCSG1|SR;synuclein, gamma (breast cancer-specific protein 1);SNCG;synuclein, gamma (breast cancer-specific protein 1)

Definition

breast cancer-specific gene 1 protein|gamma-synuclein|persyn|synoretin

Position

10q23.2-q23.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Parkinson disease;PANTHER;P00049

Disease

Cancer;FunDO

Disease

Brain disease;FunDO

External Links

Links to cell senescence gene database

6623

Links to epithelial mesenchymal transition gene database

6623

Links to ovarian cancer gene database

6623

Links to endometrial cancer gene database

6623

Links to iHOP

6623

Sequence Information

Nucleotide Sequence

>6623 : length: 855
GCAGGGCTGGCTGGGCTCCAGCTGGCCTCCGCATCAATATTTCATCGGCGTCAATAGGAG
GCATCGGGGACAGCCGCTGCGGCAGCACTCGAGCCAGCTCAAGCCCGCAGCTCGCAGGGA
GATCCAGCTCCGTCCTGCCTGCAGCAGCACAACCCTGCACACCCACCATGGATGTCTTCA
AGAAGGGCTTCTCCATCGCCAAGGAGGGCGTGGTGGGTGCGGTGGAAAAGACCAAGCAGG
GGGTGACGGAAGCAGCTGAGAAGACCAAGGAGGGGGTCATGTATGTGGGAGCCAAGACCA
AGGAGAATGTTGTACAGAGCGTGACCTCAGTGGCCGAGAAGACCAAGGAGCAGGCCAACG
CCGTGAGCGAGGCTGTGGTGAGCAGCGTCAACACTGTGGCCACCAAGACCGTGGAGGAGG
CGGAGAACATCGCGGTCACCTCCGGGGTGGTGCGCAAGGAGGACTTGAGGCCATCTGCCC
CCCAACAGGAGGGTGAGGCATCCAAAGAGAAAGAGGAAGTGGCAGAGGAGGCCCAGAGTG
GGGGAGACTAGAGGGCTACAGGCCAGCGTGGATGACCTGAAGAGCGCTCCTCTGCCTTGG
ACACCATCCCCTCCTAGCACAAGGAGTGCCCGCCTTGAGTGACATGCGGCTGCCCACGCT
CCTGCCCTCGTCTCCCTGGCCACCCTTGGCCTGTCCACCTGTGCTGCTGCACCAACCTCA
CTGCCCTCCCTCGGCCCCACCCACCCTCTGGTCCTTCTGACCCCACTTATGCTGCTGTGA
ATTTTTTTTTTAAATGATTCCAAATAAAACTTGAGCCCACTCCTGCAAAAAAAAAAAAAA
AAAAAAAAAAAAAAA

Protein Sequence

>6623 : length: 127
MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTK
EQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAE
EAQSGGD