ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6615

Name

SNAI1

Synonym

SLUGH2|SNA|SNAH|SNAIL|SNAIL1|dJ710H13.1;snail family zinc finger 1;SNAI1;snail family zinc finger 1

Definition

protein sna|protein snail homolog 1|snail 1 homolog|snail 1 zinc finger protein|snail 1, zinc finger protein|snail homolog 1|zinc finger protein SNAI1

Position

20q13.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Disease

Cancer;FunDO

Disease

Skin disease;FunDO

Disease

Oral cancer;FunDO

External Links

Links to cell senescence gene database

6615

Links to epithelial mesenchymal transition gene database

6615

Links to ovarian cancer gene database

6615

Links to endometrial cancer gene database

6615

Links to iHOP

6615

Sequence Information

Nucleotide Sequence

>6615 : length: 1722
ATTCATTGCGCCGCGGCACGGCCTAGCGAGTGGTTCTTCTGCGCTACTGCTGCGCGAATC
GGCGACCCCAGTGCCTCGACCACTATGCCGCGCTCTTTCCTCGTCAGGAAGCCCTCCGAC
CCCAATCGGAAGCCTAACTACAGCGAGCTGCAGGACTCTAATCCAGAGTTTACCTTCCAG
CAGCCCTACGACCAGGCCCACCTGCTGGCAGCCATCCCACCTCCGGAGATCCTCAACCCC
ACCGCCTCGCTGCCAATGCTCATCTGGGACTCTGTCCTGGCGCCCCAAGCCCAGCCAATT
GCCTGGGCCTCCCTTCGGCTCCAGGAGAGTCCCAGGGTGGCAGAGCTGACCTCCCTGTCA
GATGAGGACAGTGGGAAAGGCTCCCAGCCCCCCAGCCCACCCTCACCGGCTCCTTCGTCC
TTCTCCTCTACTTCAGTCTCTTCCTTGGAGGCCGAGGCCTATGCTGCCTTCCCAGGCTTG
GGCCAAGTGCCCAAGCAGCTGGCCCAGCTCTCTGAGGCCAAGGATCTCCAGGCTCGAAAG
GCCTTCAACTGCAAATACTGCAACAAGGAATACCTCAGCCTGGGTGCCCTCAAGATGCAC
ATCCGAAGCCACACGCTGCCCTGCGTCTGCGGAACCTGCGGGAAGGCCTTCTCTAGGCCC
TGGCTGCTACAAGGCCATGTCCGGACCCACACTGGCGAGAAGCCCTTCTCCTGTCCCCAC
TGCAGCCGTGCCTTCGCTGACCGCTCCAACCTGCGGGCCCACCTCCAGACCCACTCAGAT
GTCAAGAAGTACCAGTGCCAGGCGTGTGCTCGGACCTTCTCCCGAATGTCCCTGCTCCAC
AAGCACCAAGAGTCCGGCTGCTCAGGATGTCCCCGCTGACCCTCGAGGCTCCCTCTTCCT
CTCCATACCTGCCCCTGCCTGACAGCCTTCCCCAGCTCCAGCAGGAAGGACCCCACATCC
TTCTCACTGCCATGGAATTCCCTCCTGAGTGCCCCACTTCTGGCCACATCAGCCCCACAG
GACTTTGATGAAGACCATTTTCTGGTTCTGTGTCCTCTGCCTGGGCTCTGGAAGAGGCCT
TCCCATGGCCATTTCTGTGGAGGGAGGGCAGCTGGCCCCCAGCCCTGGGGGATTCCTGAG
CTGGCCTGTCTGCGTGGGTTTTTGTATCCAGAGCTGTTTGGATACAGCTGCTTTGAGCTA
CAGGACAAAGGCTGACAGACTCACTGGGAAGCTCCCACCCCACTCAGGGGACCCCACTCC
CCTCACACACACCCCCCCACAAGGAACCCTCAGGCCACCCTCCACGAGGTGTGACTAACT
ATGCAATAATCCACCCCCAGGTGCAGCCCCAGGGCCTGCGGAGGCGGTGGCAGACTAGAG
TCTGAGATGCCCCGAGCCCAGGCAGCTATTTCAGCCTCCTGTTTGGTGGGGTGGCACCTG
TTTCCCGGGCAATTTAACAATGTCTGAAAAGGGACTGTGAGTAATGGCTGTCACTTGTCG
GGGGCCCAAGTGGGGTGCTCTGGTCTGACCGATGTGTCTCCCAGAACTATTCTGGGGGCC
CGACAGGTGGGCCTGGGAGGAAGATGTTTACATTTTTAAAGGTACACTGGTATTTATATT
TCAAACATTTTGTATCAAGGAAACGTTTTGTATAGTTATATGTACAGTTTATTGATATTC
AATAAAGCAGTTAATTTATATATTAAAAAAAAAAAAAAAAAA

Protein Sequence

>6615 : length: 264
MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLI
WDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSS
LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPC
VCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQA
CARTFSRMSLLHKHQESGCSGCPR