ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6608

Name

SMO

Synonym

FZD11|Gx|SMOH;smoothened, frizzled class receptor;SMO;smoothened, frizzled class receptor

Definition

frizzled family member 11|protein Gx|seven transmembrane helix receptor|smoothened homolog|smoothened, frizzled family receptor|smoothened, seven transmembrane spanning receptor

Position

7q32.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Hedgehog signaling events mediated by Gli proteins;PID Curated;200147

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Hedgehog signaling pathway;PANTHER;P00025

Pathway

Signaling events mediated by the Hedgehog family;PID Curated;200144

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Class B/2 (Secretin family receptors);PID Reactome;500428

Disease

Basal cell carcinoma, somatic;OMIM

Disease

Hyperglycemia;FunDO

Disease

Cancers;KEGG DISEASE

Disease

Bone disease;FunDO

Disease

Chondrosarcoma;FunDO

Disease

Basal cell carcinoma;KEGG DISEASE;H00039

Disease

Skin cancer;FunDO

Disease

Pancreas cancer;FunDO

Disease

Skin cancers;KEGG DISEASE

External Links

Links to cell senescence gene database

6608

Links to epithelial mesenchymal transition gene database

6608

Links to ovarian cancer gene database

6608

Links to endometrial cancer gene database

6608

Links to iHOP

6608

Sequence Information

Nucleotide Sequence

>6608 : length: 3772
GGGCTGAAGACAACTTGGATTGCGAGGCTAGGGCTTGGGGAGTCGTGCATCCCGTTCCGG
GCCTCCGCAGCCCAACATGGGCCCCGGGTTCCAAAGTTTGCGAAGTTGGGCGCCGAGGGG
CCGGGGCGCGCGGAGCGTCCGGGGGGGCCCGGGCCCGGATTCTCTGGGCGCACAGGTCGC
CTGAGCCGCCTCCGCGGCCGCCGAGGTCGTGCGTGTGGCCGGGGGGCTCCGAGGAGCAGG
CGGGGGCGCCGGGGCTTTTGCTGAGTTGGCGGGGTTGGCCATGGCCGCTGCCCGCCCAGC
GCGGGGGCCGGAGCTCCCGCTCCTGGGGCTGCTGCTGCTGCTGCTGCTGGGGGACCCGGG
CCGGGGGGCGGCCTCGAGCGGGAACGCGACCGGGCCTGGGCCTCGGAGCGCGGGCGGGAG
CGCGAGGAGGAGCGCGGCGGTGACTGGCCCTCCGCCGCCGCTGAGCCACTGCGGCCGGGC
TGCCCCCTGCGAGCCGCTGCGCTACAACGTGTGCCTGGGCTCGGTGCTGCCCTACGGGGC
CACCTCCACACTGCTGGCCGGAGACTCGGACTCCCAGGAGGAAGCGCACGGCAAGCTCGT
GCTCTGGTCGGGCCTCCGGAATGCCCCCCGCTGCTGGGCAGTGATCCAGCCCCTGCTGTG
TGCCGTATACATGCCCAAGTGTGAGAATGACCGGGTGGAGCTGCCCAGCCGTACCCTCTG
CCAGGCCACCCGAGGCCCCTGTGCCATCGTGGAGAGGGAGCGGGGCTGGCCTGACTTCCT
GCGCTGCACTCCTGACCGCTTCCCTGAAGGCTGCACGAATGAGGTGCAGAACATCAAGTT
CAACAGTTCAGGCCAGTGCGAAGTGCCCTTGGTTCGGACAGACAACCCCAAGAGCTGGTA
CGAGGACGTGGAGGGCTGCGGCATCCAGTGCCAGAACCCGCTCTTCACAGAGGCTGAGCA
CCAGGACATGCACAGCTACATCGCGGCCTTCGGGGCCGTCACGGGCCTCTGCACGCTCTT
CACCCTGGCCACATTCGTGGCTGACTGGCGGAACTCGAATCGCTACCCTGCTGTTATTCT
CTTCTACGTCAATGCGTGCTTCTTTGTGGGCAGCATTGGCTGGCTGGCCCAGTTCATGGA
TGGTGCCCGCCGAGAGATCGTCTGCCGTGCAGATGGCACCATGAGGCTTGGGGAGCCCAC
CTCCAATGAGACTCTGTCCTGCGTCATCATCTTTGTCATCGTGTACTACGCCCTGATGGC
TGGTGTGGTTTGGTTTGTGGTCCTCACCTATGCCTGGCACACTTCCTTCAAAGCCCTGGG
CACCACCTACCAGCCTCTCTCGGGCAAGACCTCCTACTTCCACCTGCTCACCTGGTCACT
CCCCTTTGTCCTCACTGTGGCAATCCTTGCTGTGGCGCAGGTGGATGGGGACTCTGTGAG
TGGGATTTGTTTTGTGGGCTACAAGAACTACCGATACCGTGCGGGCTTCGTGCTGGCCCC
AATCGGCCTGGTGCTCATCGTGGGAGGCTACTTCCTCATCCGAGGAGTCATGACTCTGTT
CTCCATCAAGAGCAACCACCCCGGGCTGCTGAGTGAGAAGGCTGCCAGCAAGATCAACGA
GACCATGCTGCGCCTGGGCATTTTTGGCTTCCTGGCCTTTGGCTTTGTGCTCATTACCTT
CAGCTGCCACTTCTACGACTTCTTCAACCAGGCTGAGTGGGAGCGCAGCTTCCGGGACTA
TGTGCTATGTCAGGCCAATGTGACCATCGGGCTGCCCACCAAGCAGCCCATCCCTGACTG
TGAGATCAAGAATCGCCCGAGCCTTCTGGTGGAGAAGATCAACCTGTTTGCCATGTTTGG
AACTGGCATCGCCATGAGCACCTGGGTCTGGACCAAGGCCACGCTGCTCATCTGGAGGCG
TACCTGGTGCAGGTTGACTGGGCAGAGTGACGATGAGCCAAAGCGGATCAAGAAGAGCAA
GATGATTGCCAAGGCCTTCTCTAAGCGGCACGAGCTCCTGCAGAACCCAGGCCAGGAGCT
GTCCTTCAGCATGCACACTGTGTCCCACGACGGGCCCGTGGCGGGCTTGGCCTTTGACCT
CAATGAGCCCTCAGCTGATGTCTCCTCTGCCTGGGCCCAGCATGTCACCAAGATGGTGGC
TCGGAGAGGAGCCATACTGCCCCAGGATATTTCTGTCACCCCTGTGGCAACTCCAGTGCC
CCCAGAGGAACAAGCCAACCTGTGGCTGGTTGAGGCAGAGATCTCCCCAGAGCTGCAGAA
GCGCCTGGGCCGGAAGAAGAAGAGGAGGAAGAGGAAGAAGGAGGTGTGCCCGCTGGCGCC
GCCCCCTGAGCTTCACCCCCCTGCCCCTGCCCCCAGTACCATTCCTCGACTGCCTCAGCT
GCCCCGGCAGAAATGCCTGGTGGCTGCAGGTGCCTGGGGAGCTGGGGACTCTTGCCGACA
GGGAGCGTGGACCCTGGTCTCCAACCCATTCTGCCCAGAGCCCAGTCCCCCTCAGGATCC
ATTTCTGCCCAGTGCACCGGCCCCCGTGGCATGGGCTCATGGCCGCCGACAGGGCCTGGG
GCCTATTCACTCCCGCACCAACCTGATGGACACAGAACTCATGGATGCAGACTCGGACTT
CTGAGCCTGCAGAGCAGGACCTGGGACAGGAAAGAGAGGAACCAATACCTTCAAGGCTCT
TCTTCCTCACCGAGCATGCTTCCCTAGGATCCCGTCTTCCAGAGAACCTGTGGGCTGACT
GCCCTCCGAAGAGAGTTCTGGATGTCTGGCTCAAAGCAGCAGGACTGTGGGAAAGAGCCT
AACATCTCCATGGGGAGGCCTCACCCCAGGGACAGGGCCCTGGAGCTCAGGGTCCTTGTT
TCTGCCCTGCCAGCTGCAGCCTGGTTGGCAGCATCTGCTCCATCGGGGCAGGGGGTATGC
AGAGCTTGTGGTGGGGCAGGAACGGTGGAGGCAGAGGTGACAGTTCCCAGAGTGGGCTTT
GGTGGCCAGGGAGGCAGCCTAGCCTATGTCTGGCAGATGAGGGCTGGCTGCCGTTTTCTG
GGCTGATGGGTGCCCTTTCCTGGCAGTCTCAGTCCAAAAGTGTTGACTGTGTCATTAGTC
CTTTGTCTAAGTAGGGCCAGGGCACCGTATTCCTCTCCCAGGTGTTTGTGGGGCTGGAAG
GACCTGCTCCCACAGGGGCCATGTCCTCTCTTAATAGGTGGCACTACCCCAAACCCATCT
TTTGTTCTCCTATATCCTCCTTCTCCTGTTCCATTTCAGTTCAGTTTCAGCGGTGCCAAC
CTCTTTGCGTTTCCTTTTTGTTGATGAGGACCCAGAGCTGCTGCACACACTCACCTCTAA
CCCCCTCCCCTCGCTGCTGGGCCCCATCTCCACAGGAGAGACTGGTTCAGCTCTAGGGCC
TCAGTCTGGAGTGGGATAGGAGCAGTGAGTGACAAAGCCTCTGAAAGATGCATCATCTCT
TCCTCACACCCATTTAGTGGGGGATGGGTCCTCTAGACTTGAGGGGCTACCCTGGGAAGC
TGCCGTAGCTTCAGCCAGGCAAGAAAGCTTCCTTCAACCTGCATAGCCGGTGGGTGAGGA
GATTCCCACCTTCCATAGCCTCCAAACATGTTCCCAAGGCCCCACTTTCAAGAATCAGAC
AGCAGGAAGCCATAGATGCTGGCTGGGTTCCAGGTTATGGGGAGAAGAAATACAGTCAAT
AAAAGGTTTTTGTATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>6608 : length: 787
MAAARPARGPELPLLGLLLLLLLGDPGRGAASSGNATGPGPRSAGGSARRSAAVTGPPPP
LSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWA
VIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDRFPEGCTN
EVQNIKFNSSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAV
TGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGT
MRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYF
HLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLI
RGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEW
ERSFRDYVLCQANVTIGLPTKQPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKA
TLLIWRRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDGPV
AGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEEQANLWLVEAE
ISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWG
AGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTEL
MDADSDF