ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

655

Name

BMP7

Synonym

OP-1;bone morphogenetic protein 7;BMP7;bone morphogenetic protein 7

Definition

osteogenic protein 1

Position

20q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

BMP receptor signaling;PID Curated;200123

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

ALK2 signaling events;PID Curated;200138

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

alk in cardiac myocytes;PID BioCarta;100244

Disease

Response to citalopram treatment;NHGRI

Disease

Diabetes mellitus;FunDO

Disease

Chronic rejection of renal transplant;FunDO

Disease

Ankylosis;FunDO

Disease

Osteoporosis;FunDO

Disease

PHARMACOGENOMIC;GAD

Disease

Cancer;FunDO

Disease

response to citalopram treatment;GAD

Disease

Cirrhosis;FunDO

Disease

Hypertension, Pulmonary;FunDO

Disease

Arthritis;FunDO

External Links

Links to cell senescence gene database

655

Links to epithelial mesenchymal transition gene database

655

Links to ovarian cancer gene database

655

Links to endometrial cancer gene database

655

Links to iHOP

655

Sequence Information

Nucleotide Sequence

>655 : length: 4049
AGCGCGTACCACTCTGGCGCTCCCGAGGCGGCCTCTTGTGCGATCCAGGGCGCACAAGGC
TGGGAGAGCGCCCCGGGGCCCCTGCTATCCGCGCCGGAGGTTGGAAGAGGGTGGGTTGCC
GCCGCCCGAGGGCGAGAGCGCCAGAGGAGCGGGAAGAAGGAGCGCTCGCCCGCCCGCCTG
CCTCCTCGCTGCCTCCCCGGCGTTGGCTCTCTGGACTCCTAGGCTTGCTGGCTGCTCCTC
CCACCCGCGCCCGCCTCCTCACTCGCCTTTTCGTTCGCCGGGGCTGCTTTCCAAGCCCTG
CGGTGCGCCCGGGCGAGTGCGGGGCGAGGGGCCCGGGGCCAGCACCGAGCAGGGGGCGGG
GGTCCGGGCAGAGCGCGGCCGGCCGGGGAGGGGCCATGTCTGGCGCGGGCGCAGCGGGGC
CCGTCTGCAGCAAGTGACCGAGCGGCGCGGACGGCCGCCTGCCCCCTCTGCCACCTGGGG
CGGTGCGGGCCCGGAGCCCGGAGCCCGGGTAGCGCGTAGAGCCGGCGCGATGCACGTGCG
CTCACTGCGAGCTGCGGCGCCGCACAGCTTCGTGGCGCTCTGGGCACCCCTGTTCCTGCT
GCGCTCCGCCCTGGCCGACTTCAGCCTGGACAACGAGGTGCACTCGAGCTTCATCCACCG
GCGCCTCCGCAGCCAGGAGCGGCGGGAGATGCAGCGCGAGATCCTCTCCATTTTGGGCTT
GCCCCACCGCCCGCGCCCGCACCTCCAGGGCAAGCACAACTCGGCACCCATGTTCATGCT
GGACCTGTACAACGCCATGGCGGTGGAGGAGGGCGGCGGGCCCGGCGGCCAGGGCTTCTC
CTACCCCTACAAGGCCGTCTTCAGTACCCAGGGCCCCCCTCTGGCCAGCCTGCAAGATAG
CCATTTCCTCACCGACGCCGACATGGTCATGAGCTTCGTCAACCTCGTGGAACATGACAA
GGAATTCTTCCACCCACGCTACCACCATCGAGAGTTCCGGTTTGATCTTTCCAAGATCCC
AGAAGGGGAAGCTGTCACGGCAGCCGAATTCCGGATCTACAAGGACTACATCCGGGAACG
CTTCGACAATGAGACGTTCCGGATCAGCGTTTATCAGGTGCTCCAGGAGCACTTGGGCAG
GGAATCGGATCTCTTCCTGCTCGACAGCCGTACCCTCTGGGCCTCGGAGGAGGGCTGGCT
GGTGTTTGACATCACAGCCACCAGCAACCACTGGGTGGTCAATCCGCGGCACAACCTGGG
CCTGCAGCTCTCGGTGGAGACGCTGGATGGGCAGAGCATCAACCCCAAGTTGGCGGGCCT
GATTGGGCGGCACGGGCCCCAGAACAAGCAGCCCTTCATGGTGGCTTTCTTCAAGGCCAC
GGAGGTCCACTTCCGCAGCATCCGGTCCACGGGGAGCAAACAGCGCAGCCAGAACCGCTC
CAAGACGCCCAAGAACCAGGAAGCCCTGCGGATGGCCAACGTGGCAGAGAACAGCAGCAG
CGACCAGAGGCAGGCCTGTAAGAAGCACGAGCTGTATGTCAGCTTCCGAGACCTGGGCTG
GCAGGACTGGATCATCGCGCCTGAAGGCTACGCCGCCTACTACTGTGAGGGGGAGTGTGC
CTTCCCTCTGAACTCCTACATGAACGCCACCAACCACGCCATCGTGCAGACGCTGGTCCA
CTTCATCAACCCGGAAACGGTGCCCAAGCCCTGCTGTGCGCCCACGCAGCTCAATGCCAT
CTCCGTCCTCTACTTCGATGACAGCTCCAACGTCATCCTGAAGAAATACAGAAACATGGT
GGTCCGGGCCTGTGGCTGCCACTAGCTCCTCCGAGAATTCAGACCCTTTGGGGCCAAGTT
TTTCTGGATCCTCCATTGCTCGCCTTGGCCAGGAACCAGCAGACCAACTGCCTTTTGTGA
GACCTTCCCCTCCCTATCCCCAACTTTAAAGGTGTGAGAGTATTAGGAAACATGAGCAGC
ATATGGCTTTTGATCAGTTTTTCAGTGGCAGCATCCAATGAACAAGATCCTACAAGCTGT
GCAGGCAAAACCTAGCAGGAAAAAAAAACAACGCATAAAGAAAAATGGCCGGGCCAGGTC
ATTGGCTGGGAAGTCTCAGCCATGCACGGACTCGTTTCCAGAGGTAATTATGAGCGCCTA
CCAGCCAGGCCACCCAGCCGTGGGAGGAAGGGGGCGTGGCAAGGGGTGGGCACATTGGTG
TCTGTGCGAAAGGAAAATTGACCCGGAAGTTCCTGTAATAAATGTCACAATAAAACGAAT
GAATGAAAATGGTTAGGACGTTACAGATATATTTTCCTAAACAATTTATCCCCATTTCTC
GGTTTATCCTGATGCGTAAACAGAAGCTGTGTCAAGTGGAGGGCGGGGAGGTCCCTCTCC
ATTCCCTACAGTTTTCATCCTGAGGCTTGCAGAGGCCCAGTGTTTACCGAGGTTTGCCCA
AATCCAAGATCTAGTGGGAGGGGAAAGAGCAAATGTCTGCTCCGAGGAGGGCGGTGTGTT
GATCTTTGGAGGAAAAATATGTTCTGTTGTTCAGCTGGATTTGCCGTGGCAGAAATGAAA
CTAGGTGTGTGAAATACCCGCAGACATTTGGGATTGGCTTTTCACCTCGCCCCAGTGGTA
GTAAATCCATGTGAAATTGCAGAGGGGACAAGGACAGCAAGTAGGATGGAACTTGCAACT
CAACCCTGTTGTTAAGAAGCACCAATGGGCCGGGCACAGTAGCTCCCACCTGTAATCCCA
GCACTTTGGGAGGCTGAGGTGGGCGGATCATTTGAGGTCAGGAGTTCGAGACCAGCCTGG
CCAACATGGTGAAACCCCATCTCTACTAAAAATACAAAAATTAGCCGGGCATGGTGGCAC
GCACCTGTAATCCCAGCTACTCTGGAGGCTGAGGCAGGAGAATTGCTTGAACCCCAGAGG
TGGAGGTTGCAGTGAGCCAAGATCGTCCCACTGCACTCCAGCTTGGGTGACAAAACAAGA
CTCCATCTCAAAAGAAAAAAAAAACAGCACCAATGAAGCCTAGTTCTCCACGGGAGTGGG
GTGAGCAGGAGCACTGCACATCGCCCCAGTGGACCCTCTGGTCTTTGTCTGCAGTGGCAT
TCCAAGGCTGGGCCCTGGCAAGGGCACCCGTGGCTGTCTCTTCATTTGCAGACCCTGATC
AGAAGTCTCTGCAAACAAATTTGCTCCTTGAATTAAGGGGGAGATGGCATAATAGGAGGT
CTGATGGGTGCAGGATGTGCTGGACTTACATTGCAAATAGAAGCCTTGTTGAGGGTGACA
TCCTAACCAAGTGTCCCGATTTGGAGGTGGCATTTCTGACGTGGCTCTTGGTGTAAGCCT
GCCTTGCCTTGGCTGGTGAGTCCCATAAATAGTATGCACTCAGCCTCCGGCCACAAACAC
AAGGCCTAGGGGAGGGCTAGACTGTCTGCAAACGTTTTCTGCATCTGTAAAGAAAACAAG
GTGATCGAAAACTGTGGCCATGTGGAACCCGGTCTTGTGGGGGACTGTTTCTCCATCTTG
ACTCAGACAGTTCCTGGAAACACCGGGGCTCTGTTTTTATTTTCTTTGATGTTTTTCTTC
TTTAGTAGCTTGGGCTGCAGCCTCCACTCTCTAGTCACTGGGGAGGAGTATTTTTTGTTA
TGTTTGGTTTCATTTGCTGGCAGAGCTGGGGCTTTTTGTGTGATCCCTCTTGGTGTGAGT
TTTCTGACCCAACCAGCCTCTGGTTAGCATCATTTGTACATTTAAACCTGTAAATAGTTG
TTACAAAGCAAAGAGATTATTTATTTCCATCCAAAGCTCTTTTGAACACCCCCCCCCCTT
TAATCCCTCGTTCAGGACGATGAGCTTGCTTTCCTTCAACCTGTTTGTTTTCTTATTTAA
GACTATTTATTAATGGTTGGACCAATGTACTCACAGCTGTTGCGTCGAGCAGTCCTTAGT
GAAAATTCTGTATAAATAGACAAAATGAAAAGGGTTTGACCTTGCAATAAAAGGAGACGT
TTGGTTCTGGCAAAAAAAAAAAAAAAAAA

Protein Sequence

>655 : length: 431
MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILS
ILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLAS
LQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDY
IRERFDNETFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPR
HNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRS
QNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCE
GECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKY
RNMVVRACGCH