ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6520

Name

SLC3A2

Synonym

4F2|4F2HC|4T2HC|CD98|CD98HC|MDU1|NACAE;solute carrier family 3 (amino acid transporter heavy chain), member 2;SLC3A2;solute carrier family 3 (amino acid transporter heavy chain), member 2

Definition

4F2 cell-surface antigen heavy chain|CD98 heavy chain|antigen defined by monoclonal antibody 4F2, heavy chain|antigen identified by monoclonal antibodies 4F2, TRA1.10, TROP4, and T43|lymphocyte activation antigen 4F2 large subunit|monoclonal antibody 44D7

Position

11q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039

Pathway

Protein digestion and absorption;KEGG PATHWAY;hsa04974

Pathway

Metabolism of amino acids and derivatives;Reactome;REACT:13

Pathway

Amino acid transport across the plasma membrane;PID Reactome;500341

Pathway

Transmembrane transport of small molecules;Reactome;REACT:15518

Pathway

Amino acid and oligopeptide SLC transporters;Reactome;REACT:19419

Disease

Cancer;FunDO

Disease

Neoplasm metastasis;FunDO

External Links

Links to cell senescence gene database

6520

Links to epithelial mesenchymal transition gene database

6520

Links to ovarian cancer gene database

6520

Links to endometrial cancer gene database

6520

Links to iHOP

6520

Sequence Information

Nucleotide Sequence

>6520 : length: 2350
AGTTCCAGGGAAGGAGGGCGTAGACAAAGCGCCACCTGAACTTGCGGCGCGAAAAAGGCG
CGCATGCGTCCTACGGGAGCGTGCTGGCTCACCGACCGCATTGCGGCTTGGTTTTCTCAC
CCAGTGCATGTGGCAGGAGCGGTGAGATCACTGCCTCACGGCGATCCTGGACTGACGGTC
ACGACTGCCTACCCTCTAACCCTGTTCTGAGCTGCCCCTTGCCCACACACCCCAAACCTG
TGTGCAGGATCCGCCTCCATGGAGCTACAGCCTCCTGAAGCCTCGATCGCCGTCGTGTCG
ATTCCGCGCCAGTTGCCTGGCTCACATTCGGAGGCTGGTGTCCAGGGTCTCAGCGCGGGG
GACGACTCAGAGACGGGGTCTGACTGTGTTACCCAGGCTGGTCTTCAACTCTTGGCCTCA
AGTGATCCTCCTGCCTTAGCTTCCAAGAATGCTGAGGTTACAGTAGAAACGGGGTTTCAC
CATGTTAGCCAGGCTGATATTGAATTCCTGACCTCAATTGATCCGACTGCCTCGGCCTCC
GGAAGTGCTGGGATTACAGGCACCATGAGCCAGGACACCGAGGTGGATATGAAGGAGGTG
GAGCTGAATGAGTTAGAGCCCGAGAAGCAGCCGATGAACGCGGCGTCTGGGGCGGCCATG
TCCCTGGCGGGAGCCGAGAAGAATGGTCTGGTGAAGATCAAGGTGGCGGAAGACGAGGCG
GAGGCGGCAGCCGCGGCTAAGTTCACGGGCCTGTCCAAGGAGGAGCTGCTGAAGGTGGCA
GGCAGCCCCGGCTGGGTACGCACCCGCTGGGCACTGCTGCTGCTCTTCTGGCTCGGCTGG
CTCGGCATGCTTGCTGGTGCCGTGGTCATAATCGTGCGAGCGCCGCGTTGTCGCGAGCTA
CCGGCGCAGAAGTGGTGGCACACGGGCGCCCTCTACCGCATCGGCGACCTTCAGGCCTTC
CAGGGCCACGGCGCGGGCAACCTGGCGGGTCTGAAGGGGCGTCTCGATTACCTGAGCTCT
CTGAAGGTGAAGGGCCTTGTGCTGGGTCCAATTCACAAGAACCAGAAGGATGATGTCGCT
CAGACTGACTTGCTGCAGATCGACCCCAATTTTGGCTCCAAGGAAGATTTTGACAGTCTC
TTGCAATCGGCTAAAAAAAAGAGCATCCGTGTCATTCTGGACCTTACTCCCAACTACCGG
GGTGAGAACTCGTGGTTCTCCACTCAGGTTGACACTGTGGCCACCAAGGTGAAGGATGCT
CTGGAGTTTTGGCTGCAAGCTGGCGTGGATGGGTTCCAGGTTCGGGACATAGAGAATCTG
AAGGATGCATCCTCATTCTTGGCTGAGTGGCAAAATATCACCAAGGGCTTCAGTGAAGAC
AGGCTCTTGATTGCGGGGACTAACTCCTCCGACCTTCAGCAGATCCTGAGCCTACTCGAA
TCCAACAAAGACTTGCTGTTGACTAGCTCATACCTGTCTGATTCTGGTTCTACTGGGGAG
CATACAAAATCCCTAGTCACACAGTATTTGAATGCCACTGGCAATCGCTGGTGCAGCTGG
AGTTTGTCTCAGGCAAGGCTCCTGACTTCCTTCTTGCCGGCTCAACTTCTCCGACTCTAC
CAGCTGATGCTCTTCACCCTGCCAGGGACCCCTGTTTTCAGCTACGGGGATGAGATTGGC
CTGGATGCAGCTGCCCTTCCTGGACAGCCTATGGAGGCTCCAGTCATGCTGTGGGATGAG
TCCAGCTTCCCTGACATCCCAGGGGCTGTAAGTGCCAACATGACTGTGAAGGGCCAGAGT
GAAGACCCTGGCTCCCTCCTTTCCTTGTTCCGGCGGCTGAGTGACCAGCGGAGTAAGGAG
CGCTCCCTACTGCATGGGGACTTCCACGCGTTCTCCGCTGGGCCTGGACTCTTCTCCTAT
ATCCGCCACTGGGACCAGAATGAGCGTTTTCTGGTAGTGCTTAACTTTGGGGATGTGGGC
CTCTCGGCTGGACTGCAGGCCTCCGACCTGCCTGCCAGCGCCAGCCTGCCAGCCAAGGCT
GACCTCCTGCTCAGCACCCAGCCAGGCCGTGAGGAGGGCTCCCCTCTTGAGCTGGAACGC
CTGAAACTGGAGCCTCACGAAGGGCTGCTGCTCCGCTTCCCCTACGCGGCCTGACTTCAG
CCTGACATGGACCCACTACCCTTCTCCTTTCCTTCCCAGGCCCTTTGGCTTCTGATTTTT
CTCTTTTTTAAAAACAAACAAACAAACTGTTGCAGATTATGAGTGAACCCCCAAATAGGG
TGTTTTCTGCCTTCAAATAAAAGTCACCCCTGCATGGTGAAGTCTTCCCTCTGCTTCTCT
CATAAAAAAA

Protein Sequence

>6520 : length: 631
MELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSETGSDCVTQAGLQLLASSDPPAL
ASKNAEVTVETGFHHVSQADIEFLTSIDPTASASGSAGITGTMSQDTEVDMKEVELNELE
PEKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLSKEELLKVAGSPGWV
RTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAG
NLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKK
KSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSF
LAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLV
TQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAAL
PGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHG
DFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLST
QPGREEGSPLELERLKLEPHEGLLLRFPYAA