ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

65123

Name

INTS3

Synonym

C1orf193|C1orf60|INT3|SOSS-A|SOSSA;integrator complex subunit 3;INTS3;integrator complex subunit 3

Definition

SOSS complex subunit A|sensor of single-strand DNA complex subunit A|sensor of ssDNA A|sensor of ssDNA subunit A

Position

1q21.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

65123

Links to epithelial mesenchymal transition gene database

65123

Links to ovarian cancer gene database

65123

Links to endometrial cancer gene database

65123

Links to iHOP

65123

Sequence Information

Nucleotide Sequence

>65123 : length: 5450
GCCTTCCCACCCCCCGCCCTTCCACTATGGCCGCTTCTGTGTGGTGTGGGGAGACGCTGG
TCCTCCCCGTCCTCCCATAGCGCTTATTGCCTCACCCTCACCCCCTAGGGGCCGGATCCA
AAGGCGCTGCACTCCCCAAGCCTTGGGGCATCAGCCAGGAAGGTTTCCTACCTCCTAATT
CAGGGGCAGGACTCCTCTTTTCCCCCCACGGGGAAAAGAGGCAGAAACTTAGGGGTTTCC
CTCCTTTCTTAGGGTCAGACGCTCTTAGGGTCCACTTCTTCAGGGGCGGAAGCCTCTCCT
ACCCTTCCCATAGGGACACAGGCCTTTACCCCACTGTACTTCGGAGCCAACGCCTTTCCC
TCAGCACTGCCACCCCAGAGTCAGGACCCAGAGGACTGTGCCTTCGCCCCCAACGCAGGC
GCGGCCTTTTGGAGAGGAGGGAGGAGTGGAGAGGACAGGGGCCCTTGCTCTCCCCTCCCC
AACTTGTTCCTCTTGCCCCCCAGTCCCTGGCAATCCAGAGATCCCGATATCTAGGACTGT
CCATCCATCCACTCCCTGACCTTTTCCCGGCTCCTGGCTGCAGCCATGGAGTTGCAGAAG
GGAAAAGGGGCGGCAGCAGCAGCAGCTGCTTCGGGAGCAGCGGGAGGTGGAGGAGGAGGA
GCGGGAGCAGGAGCCCCAGGAGGGGGGAGGCTGCTACTTTCAACCAGTTTGGATGCCAAG
GATGAGTTAGAGGAGAGATTGGAAAGGTGTATGAGCATTGTGACATCGATGACTGCTGGT
GTCTCGGAGAGAGAAGCCAATGATGCCCTCAATGCGTATGTGTGCAAAGGCCTCCCCCAG
CATGAAGAAATCTGCCTGGGCCTGTTTACTCTCATCCTCACTGAACCTGCCCAAGCCCAG
AAGTGTTACCGGGACTTAGCTCTGGTGAGTCGTGATGGCATGAATATTGTCCTGAATAAA
ATCAACCAGATACTTATGGAGAAGTACCTGAAGCTGCAGGATACCTGCCGTACTCAGTTG
GTGTGGTTGGTACGGGAACTGGTGAAGAGTGGGGTTCTGGGAGCCGATGGTGTTTGTATG
ACGTTTATGAAGCAGATTGCAGGTGGAGATGTTACAGCCAAAAATATCTGGTTGGCAGAA
AGTGTTCTGGATATCCTGACAGAGCAAAGGGAGTGGGTCCTGAAGAGCAGCATCCTCATT
GCCATGGCTGTTTACACGTACCTCCGCCTCATCGTGGACCACCATGGGACTGCCCAGCTC
CAGGCCCTGCGACAGAAGGAAGTAGACTTCTGCATCTCACTGCTTCGGGAACGGTTCATG
GAATGTCTGATGATTGGTCGGGATCTCGTAAGACTACTTCAGAATGTTGCTAGGATACCA
GAATTTGAACTGCTTTGGAAAGATATTATCCATAATCCTCAGGCCTTGAGTCCTCAGTTC
ACAGGTATCCTACAGCTTCTTCAGTCAAGAACATCCCGAAAATTCCTAGCATGTCGTCTA
ACCCCGGACATGGAGACTAAACTCCTCTTCATGACATCCCGGGTGCGATTTGGTCAACAA
AAGCGATACCAAGATTGGTTCCAGCGCCAGTACCTGTCAACTCCAGATAGTCAGTCTCTG
CGCTGTGACCTCATTCGCTACATCTGTGGGGTAGTCCACCCTTCTAATGAAGTACTGAGT
TCAGATATCTTGCCCCGGTGGGCCATCATTGGTTGGCTCCTGACAACGTGCACGTCAAAT
GTCGCTGCCTCCAATGCCAAGCTGGCTTTGTTTTATGACTGGCTGTTCTTTAGTCCAGAC
AAGGATAGCATTATGAACATAGAACCAGCCATCCTGGTCATGCACCACTCCATGAAGCCC
CACCCAGCCATCACTGCCACACTCCTGGACTTCATGTGCCGCATCATTCCCAACTTCTAT
CCACCATTGGAGGGCCACGTGCGGCAGGGTGTCTTTTCCTCCCTCAACCACATTGTGGAG
AAACGGGTCTTGGCACACCTAGCTCCCCTGTTTGACAACCCTAAGTTGGATAAGGAGCTG
CGGGCAATGCTGAGAGAGAAGTTTCCTGAGTTCTGCAGCTCACCCTCCCCACCTGTGGAA
GTCAAAATTGAGGAGCCAGTTTCCATGGAGATGGACAACCATATGTCGGATAAGGATGAG
AGTTGCTATGACAATGCAGAGGCAGCCTTCAGTGACGATGAAGAGGATCTCAACAGCAAA
GGAAAGAAGAGGGAGTTTCGCTTCCACCCTATCAAGGAGACAGTTGTGGAGGAGCCAGTT
GATATCACCCCTTACCTTGACCAGTTGGATGAGTCCCTGAGGGACAAAGTACTCCAGCTA
CAGAAGGGGAGTGATACGGAGGCCCAGTGTGAGGTCATGCAGGAAATTGTGGACCAGGTC
CTGGAGGAAGACTTTGACTCGGAGCAGCTGTCTGTCCTTGCTTCCTGCCTACAGGAGCTC
TTCAAGGCCCACTTTCGAGGGGAGGTCCTGCCTGAGGAGATTACTGAGGAGTCCCTGGAG
GAGTCTGTAGGAAAGCCTCTGTACCTAATATTTAGGAACCTATGTCAGATGCAGGAAGAC
AACAGCAGCTTCTCTCTACTTCTAGACCTTCTCTCCGAGCTATATCAGAAGCAGCCCAAG
ATTGGCTACCACCTGCTCTACTACCTGAGGGCCAGCAAAGCCGCCGCAGGGAAGATGAAC
CTGTACGAGTCATTTGCCCAGGCTACCCAGCTGGGCGATCTGCACACCTGCCTGATGATG
GACATGAAGGCCTGCCAGGAGGACGATGTGCGGCTCCTGTGCCACCTCACGCCCTCCATC
TACACAGAGTTTCCAGATGAAACCTTGAGGAGCGGAGAGCTGCTGAACATGATCGTGGCT
GTTATTGACTCTGCACAGCTCCAGGAGCTGGTCTGCCACGTGATGATGGGTAACCTGGTT
ATGTTTCGAAAAGACTCAGTTCTCAACATACTCATTCAGAGCCTAGACTGGGAGACCTTT
GAGCAGTATTGTGCCTGGCAGCTCTTTCTGGCCCACAATATTCCCCTGGAGACCATAATC
CCCATCCTGCAGCACCTCAAATACAAGGAGCACCCAGAGGCCCTGTCCTGCCTACTGCTT
CAACTCCGAAGAGAAAAGCCCAGCGAGGAGATGGTGAAGATGGTGCTGAGCCGGCCCTGC
CATCCTGACGACCAGTTCACCACCAGCATCCTGCGGCACTGGTGCATGAAACATGACGAG
CTGCTGGCCGAGCACATCAAGTCCCTGCTCATCAAGAACAACAGCCTGCCTCGCAAGAGA
CAGAGCCTGAGGAGCTCTAGCAGCAAGCTGGCCCAGCTGACTCTGGAGCAGATCCTGGAG
CACTTGGACAATCTGCGGCTCAACCTGACCAACACCAAGCAGAACTGTATGCCTTCCACC
CTCGGCGTCCAGTGTAGACGGTGCTGCCCTGGCCCAGACTATGCCTGGAGCCAGGCTGGG
GGCAGGGGCAGGACACCCGGGGCCACAACCCACACTCGGGATAAAACAACCTGTGCGTGC
TGTTTAATAAGCTCCCAGACATCTGATTGTTTTTCCTTCCCTGCTCTCCCTTTTCTTCCT
CTAGTTTTTAGCCAGACGCCAATTCTCCAGGCGCTGCAGCATGTCCAAGCGAGCTGTGAC
GAAGCCCACAAGATGAAATTCAGTGATCTCTTCTCCCTGGCGGAGGAATATGAGGACTCT
TCCACCAAGCCACCCAAGAGCCGGCGAAAAGCAGCTCTGTCCAGCCCTCGAAGTCGAAAG
AATGCCACACAGCCCCCCAATGCCGAAGAAGAGTCGGGCTCCAGCAGTGCTTCAGAAGAG
GAAGACACGAAACCGAAGCCTACCAAGCGGAAACGAAAAGGGTCCTCTGCAGTGGGCTCT
GACAGTGACTGAGGCCCTGCATTCCCCATCCCACCCCCGGCTGGACTGCCCTCTCCTTCT
TGGTGATTCAAAGGTTAATAGAGGCTGAGGAGATTGCAGGGGAAACACCCTTGCTGCATC
CCCAAGCTCCCCCGGTGGAAGGAGGAGCTTTCTCCTCTGGCTGAGTTTGAGAAGCTGCCA
TGCAGCCCCTAGCCCCTTCCCTCCTCCTGGGGCCTCCAGCCCCTCACACTGCTGTTCCCA
GTGATATTTGGGATCTGACTGAAGCCAGAGGCTCTGTAAAATCAGACCATAGTGGAAGTC
CTCAGCCCCCTGGCCCCTTCCGCAATCTCCTCCCCCAGTCTCCCAAAGAGCCATTTCAAC
AGAGAAGGGAAATGACAAAGGGGCAGCTGGCCAGATAAGCTAGGATGAGAGCAGAGACTC
AGTGTGTGGGTGTCCCTTCCTGCTTCCCCTTCAGGTCTTGGTTTGTTCTGAAGGGACGTT
TTATAGTCACTATCCACATGCCAGTGTGAAATGGGCATCTATGACGTGGTCAGGGTGTCC
ATTCCTAATCATGGGGCAGATGCCACAAGCATTCAGAAAGGAGTCTGAAAGGGTGGCCAC
AGCCCCACGTGGTGTGCCCTGGAGGCTTAGGTTGGTCTGAGGTTGGCACCTCAATCTACA
CCAGAGCCCAGGGAGTCCCAGAGGCAAGTTTCACAGAATTGTCAAATGATCCCATTTCCT
TGAGTCTGTTTTTTTTTTTGTTTTTTTTTGTTTTTTTTTTGGCAGAGATAATCGTGTCTT
AAAAGTTGTTTTTAAATGACAATAAAACAAGCCAGAATGTCTTTTGTGCTGGAGTGTCTG
CTGGCATTTGCCCCGTGCATGTATAGCTTGGTCTTGATTTGATTGGCACCCCTACTTGTA
ACCGCAGAACATCCCCCTTTCCCTTCCTGTTCTGCCCCCACTTTTGTCTAGAGCAGAAGG
GACTTGGCTTTGGCCACTACCCATCCTTCCTGCTGCCACTGGAGGTGGGAGCCAGGCACT
GATCTGTCTATGCAGAACCATCCCCCGTAGGATGAGGCCTGTCCTTACTCATTTCTCAAG
AAACAAGATGCTTCCAAAAGGTCTGTCATCCTCCAGTTGAAGTCTGTGTGCCTACCAAGA
ATGGCCGGAGGACTCGCTGCTTGACGGGAGGGATGCTCCAGCTTGGTCTCCAGGGACAAC
TGTACCTGGAGATAAAGTCTGGATACCAGGGAGGGACAGAGATGCTCTTCCTTCCACAGT
GTGGCCACTTGCTGGGCCATGTGAACCAGCAGAGGAGAGTTCCTTGGCTATGCTGTTGTT
CCCCCGCTGTCCAGGGAGAATGGAGGTGGACTGAGGAGTGAAGTTTGGGCGAACTGCACA
GAGCTGCTCCTCTTCACCCCGAAAATTTGTCTTTTTACAGAATCCAGGTTCTCCCCTCCC
TCATCACTGCTGTTGCTTCCTTTGAAAGTCTAAACCACTGGAGGCTTCTTTTTCCTTCCT
CTCTCCTTCCCCAGTTTCCTCTGTCCCAATTAAAACCAGGATGGAGAGCA

Protein Sequence

>65123 : length: 1108
MELQKGKGAAAAAAASGAAGGGGGGAGAGAPGGGRLLLSTSLDAKDELEERLERCMSIVT
SMTAGVSEREANDALNAYVCKGLPQHEEICLGLFTLILTEPAQAQKCYRDLALVSRDGMN
IVLNKINQILMEKYLKLQDTCRTQLVWLVRELVKSGVLGADGVCMTFMKQIAGGDVTAKN
IWLAESVLDILTEQREWVLKSSILIAMAVYTYLRLIVDHHGTAQLQALRQKEVDFCISLL
RERFMECLMIGRDLVRLLQNVARIPEFELLWKDIIHNPQALSPQFTGILQLLQSRTSRKF
LACRLTPDMETKLLFMTSRVRFGQQKRYQDWFQRQYLSTPDSQSLRCDLIRYICGVVHPS
NEVLSSDILPRWAIIGWLLTTCTSNVAASNAKLALFYDWLFFSPDKDSIMNIEPAILVMH
HSMKPHPAITATLLDFMCRIIPNFYPPLEGHVRQGVFSSLNHIVEKRVLAHLAPLFDNPK
LDKELRAMLREKFPEFCSSPSPPVEVKIEEPVSMEMDNHMSDKDESCYDNAEAAFSDDEE
DLNSKGKKREFRFHPIKETVVEEPVDITPYLDQLDESLRDKVLQLQKGSDTEAQCEVMQE
IVDQVLEEDFDSEQLSVLASCLQELFKAHFRGEVLPEEITEESLEESVGKPLYLIFRNLC
QMQEDNSSFSLLLDLLSELYQKQPKIGYHLLYYLRASKAAAGKMNLYESFAQATQLGDLH
TCLMMDMKACQEDDVRLLCHLTPSIYTEFPDETLRSGELLNMIVAVIDSAQLQELVCHVM
MGNLVMFRKDSVLNILIQSLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEAL
SCLLLQLRREKPSEEMVKMVLSRPCHPDDQFTTSILRHWCMKHDELLAEHIKSLLIKNNS
LPRKRQSLRSSSSKLAQLTLEQILEHLDNLRLNLTNTKQNCMPSTLGVQCRRCCPGPDYA
WSQAGGRGRTPGATTHTRDKTTCACCLISSQTSDCFSFPALPFLPLVFSQTPILQALQHV
QASCDEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKNATQPPNAEEESGSS
SASEEEDTKPKPTKRKRKGSSAVGSDSD