ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6502

Name

SKP2

Synonym

FBL1|FBXL1|FLB1|p45;S-phase kinase-associated protein 2, E3 ubiquitin protein ligase;SKP2;S-phase kinase-associated protein 2, E3 ubiquitin protein ligase

Definition

CDK2/cyclin A-associated protein p45|F-box/LRR-repeat protein 1|S-phase kinase-associated protein 2|S-phase kinase-associated protein 2 (p45)|p45skp2

Position

5p13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Regulation of retinoblastoma protein;PID Curated;200191

Pathway

p53 pathway;PID Curated;200175

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

e2f1 destruction pathway;PID BioCarta;100034

Pathway

Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

FoxO family signaling;PID Curated;200091

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Notch signaling pathway;PID Curated;200013

Pathway

cell cycle: g1/s check point;PID BioCarta;100160

Pathway

FOXM1 transcription factor network;PID Curated;200120

Pathway

C-MYC pathway;PID Curated;200093

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

regulation of p27 phosphorylation during cell cycle progression;PID BioCarta;100087

Disease

Cancer;FunDO

Disease

Skin disease;FunDO

External Links

Links to cell senescence gene database

6502

Links to epithelial mesenchymal transition gene database

6502

Links to ovarian cancer gene database

6502

Links to endometrial cancer gene database

6502

Links to iHOP

6502

Sequence Information

Nucleotide Sequence

>6502 : length: 3520
AATTCCCAGCAGGCCTTGGGCCTCAGTGCGGCCGCGAAGCAGAGCGGGCTGTAGAGCCTT
GCGCGCGCAGTGGGGATGGAACGTTGCTAGGCTTAGCGGGTCTGGCTGCTGGGGGCCCGA
GCAGCACGCTCGGAGCCGCCGCGCGCCAAAGCGGGAATCTGGGAGGCGAGCAGCTCTGCA
GTTAATGCACGTATTTTAAACTCCCGGGCCTGCGGACGCTATGCACAGGAAGCACCTCCA
GGAGATTCCAGACCTGAGTAGCAACGTTGCCACCAGCTTCACGTGGGGATGGGATTCCAG
CAAGACTTCTGAACTGCTGTCAGGCATGGGGGTCTCCGCCCTGGAGAAAGAGGAGCCCGA
CAGTGAGAACATCCCCCAGGAACTGCTCTCAAACCTGGGCCACCCGGAGAGCCCCCCACG
GAAACGGCTGAAGAGCAAAGGGAGTGACAAAGACTTTGTGATTGTCCGCAGGCCTAAGCT
AAATCGAGAGAACTTTCCAGGTGTTTCATGGGACTCCCTTCCGGATGAGCTGCTCTTGGG
AATCTTTTCCTGTCTGTGCCTCCCTGAGCTGCTAAAGGTCTCTGGTGTTTGTAAGAGGTG
GTATCGCCTAGCGTCTGATGAGTCTCTATGGCAGACCTTAGACCTCACAGGTAAAAATCT
GCACCCGGATGTGACTGGTCGGTTGCTGTCTCAAGGGGTGATTGCCTTCCGCTGCCCACG
ATCATTTATGGACCAACCATTGGCTGAACATTTCAGCCCTTTTCGTGTACAGCACATGGA
CCTATCGAACTCAGTTATAGAAGTGTCCACCCTCCACGGCATACTGTCTCAGTGTTCCAA
GTTGCAGAATCTAAGCCTGGAAGGCCTGCGGCTTTCGGATCCCATTGTCAATACTCTCGC
AAAAAACTCAAATTTAGTGCGACTTAACCTTTCTGGGTGTTCTGGATTCTCTGAATTTGC
CCTGCAGACTTTGCTAAGCAGCTGTTCCAGACTGGATGAGCTGAACCTCTCCTGGTGTTT
TGATTTCACTGAAAAGCATGTACAGGTGGCTGTTGCGCATGTGTCAGAGACCATCACCCA
GCTGAATCTTAGCGGCTACAGAAAGAATCTCCAGAAATCAGATCTCTCTACTTTAGTTAG
AAGATGCCCCAATCTTGTCCATCTAGACTTAAGTGATAGTGTCATGCTAAAGAATGACTG
CTTTCAGGAATTTTTCCAGCTCAACTACCTCCAACACCTATCACTCAGTCGGTGCTATGA
TATAATACCTGAAACTTTACTTGAACTTGGAGAAATTCCCACACTAAAAACACTACAAGT
TTTTGGAATCGTGCCAGATGGTACCCTTCAACTGTTAAAGGAAGCCCTTCCTCATCTACA
GATTAATTGCTCCCATTTCACCACCATTGCCAGGCCAACTATTGGCAACAAAAAGAACCA
GGAGATATGGGGCATCAAATGCCGACTGACACTGCAAAAGCCCAGTTGTCTATGAAGTAT
TTATTGCAGGATGGTGTCTCTTCTTTAGAACAGGGAAAATAGGCAGGAAGCCCAATTGCT
GGAGTACTTAGCTAGTTTTATTCTTGGTTTTCCCTTTGCCTTCATTCTGCAAGTATACTA
GGGAGCCATTTGAGAGGGAAAACTATGAAATCTTGCTTTTTGAAATGATTCTAAAAGCTT
CTATCACTGCTTTGCTCTTAAGAGCCAAAGTTGTAGGCCTTTTGAAATTTTAGGAGAGTG
AGCCTATAATTTCAAGATACCTTAAAGAGCAAAATTTGAGCCACCTCTTCCAAGTGCCCT
TCTTACTAAGTCTATTCAGAATCAAGCTTAAAAATTACCACCAGCAAACAATCTTCATAG
CCCATATAACTTTTATCTATTTAATTTTATAGTATTGCTTTATAAGACAGCTTAGAAGAA
CAATAAGCTATTTGTATTATGAGCTGAACAAAAAGAGAATCATAGGATAGTAGCGTCTGA
GGCCATCTTTTCTAGGAATAGGAAAGAGAAAAATGTATTTGAATTTTGCCTTTAGATTTG
AAATTAGGTTAATAGAAATAAGTAACCCCATGTAATTCACCTTAAAACTTAACAAAAGAC
CAAACATTACAAAACCCAGAGATATAGAATCAATATAGGATTTGAAGGCCCAGCAGACAG
TTTTCTATGACAGGTTAATCTGAAGTATCCTGTAATGTTCATTAAGTTACTGTGTTTCCA
GAATCTAAATTAGATGAGAAATATAATTGTGGTTTTCTAACTTGATAATCAAATTATGTT
AACATGGGTCCTTTAGCTTTTAAAATGACTTGCTTTGTTTTAGAAAGGTGGTATTAATCC
ACTCTCTATTCTTGAAAATTTGGATGGGAGAATTCTGAAGTTGCCTGCTGTTTTCCTTTA
GCGCTGAGGTTCTTAAGGTTACTTTTATATTACTCTGGAATCAAGTATTTTAAATTGTAT
TTTTTTTTTAAATGATCTCTCAGCAATAATTGTTTGAAACTATCCATATATAAGGTTATC
AGACCTACAGTTCCCTAAGAGGAACTGCATGTTCTCTTCAATCAGAAATATACAGTAGAA
GCAGGTATATCTTCCATGCAGTTTCAGTAGTAAGCACTACTTATACCTACATAAGAGTTA
AAATCCAGATGTGGGACCTTTTGATACCATCAGTGATATATATTTTTTTAAACTGGTACA
GAGAAGTGAAAAGATTAAATTCTACTTCTATTTTTTTTTTTTTTTTTTGAGACGGAGTCT
CGCTCTGTCACCAAGGCCGGAGTGCAGTGGTGCGATCTCGGCTCACTGCAAGCTCCGCCT
CCCAGGTTCACGTCATTCTCCTGCCTCAGCCTCCCGACTAGCTGGGACTACAGGCGCCCA
CCACCACGCCCGGCTAATTTTTTTGTATTTTTAGTAGAGACGGGGTTTCACCATGTTAGC
CAGGATGGTCTCAATCTCCTGACCTCATGATCCGCCCGTCTTGGCCTCCCAAAGTGCTGG
GATTACAGGCATGAGCAACTGCGCCCAGCCAAATTCTACTTCTTAAAAATCACAAAAACT
AGTTTAAATTGATGACTTGTTCGTATGTTCAAAATGTAACAACAAAAAAAGCTAACACCA
GTCATTTATATTAACTTTTTTTTTTTAAATCAAAAATTGTTAATGTTAGAAACATACTAT
GAAGTGCCTTTATCTGCTTAGACCTAAGGAAGATTTTAAAGTTGGGTTGCACAGGAAATG
ATGATGCTTCAATTTCTTAATAGTTAAAAAGTGCTAAATACTACTTGAAATTATTGTTTA
CAGATTAGTGACAAGAGCTGGGGTTAGGATCCGGTTGGACTCTGACATCGGATGCCCTCA
AACATACAGAACTTCCAAACTCAAGTCCAGCCATAAGCTATTTTGCCAACATGTCAGAGT
AATCTGTATTTTTGTATGTGATTTCTACTTTTATAGACTTGTTTTAAAACAATAAAACAC
ATTTTTATAAAAATGAGTGCTTAAAAAAAAAAAAAAAAAA

Protein Sequence

>6502 : length: 424
MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLG
HPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV
SGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSP
FRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGC
SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS
DLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIP
TLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQK
PSCL