ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6497

Name

SKI

Synonym

SGS|SKV;SKI proto-oncogene;SKI;SKI proto-oncogene

Definition

proto-oncogene c-Ski|ski oncogene|ski oncoprotein|v-ski avian sarcoma viral oncogene homolog

Position

1p36.33

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by BMP;PID Reactome;500592

Pathway

Signaling by TGF beta;PID Reactome;500590

Pathway

BMP receptor signaling;PID Curated;200123

Pathway

Signaling by BMP;Reactome;REACT:12034

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

BMP Signalling Pathway;BioCyc;PWY66-11

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

Signaling by TGF beta;Reactome;REACT:6844

Disease

Scleroderma;FunDO

Disease

Systemic scleroderma;FunDO

Disease

Barrett's esophagus;FunDO

Disease

Leukemia;FunDO

Disease

Melanoma;FunDO

Disease

1p36 deletion syndrome;OMIM

Disease

Esophagus cancer;FunDO

External Links

Links to cell senescence gene database

6497

Links to epithelial mesenchymal transition gene database

6497

Links to ovarian cancer gene database

6497

Links to endometrial cancer gene database

6497

Links to iHOP

6497

Sequence Information

Nucleotide Sequence

>6497 : length: 5707
CGGGGCGGCGGCGGGGGCCGGGGGGGCCCGGGCGCGCGGGAGCGGGAGCGGCCGGGGGAG
CCGGAGCGCACCATGGAGGCGGCGGCAGGCGGCCGCGGCTGTTTCCAGCCGCACCCGGGG
CTGCAGAAGACGCTGGAGCAGTTCCACCTGAGCTCCATGAGCTCGCTGGGCGGCCCGGCC
GCTTTCTCGGCGCGCTGGGCGCAGGAGGCCTACAAGAAGGAGAGCGCCAAGGAGGCGGGC
GCGGCCGCGGTGCCGGCGCCGGTGCCCGCAGCCACCGAGCCGCCGCCCGTGCTGCACCTG
CCCGCCATCCAGCCGCCGCCGCCCGTGCTGCCCGGGCCCTTCTTCATGCCGTCCGACCGC
TCCACCGAGCGCTGCGAGACCGTACTGGAAGGCGAGACCATCTCGTGCTTCGTGGTGGGA
GGCGAGAAGCGCCTGTGTCTGCCGCAGATTCTCAACTCGGTGCTGCGCGACTTCTCGCTG
CAGCAGATCAACGCGGTGTGCGACGAGCTCCACATCTACTGCTCGCGCTGCACGGCCGAC
CAGCTGGAGATCCTCAAAGTCATGGGCATCCTGCCCTTCTCGGCGCCCTCGTGCGGGCTC
ATCACCAAGACGGACGCCGAGCGCCTGTGCAACGCGCTGCTCTACGGCGGCGCCTACCCG
CCGCCCTGCAAGAAGGAGCTGGCCGCCAGCCTGGCGCTGGGCCTGGAGCTCAGCGAGCGC
AGCGTCCGCGTGTACCACGAGTGCTTCGGCAAGTGTAAGGGGCTGCTGGTGCCCGAGCTC
TACAGCAGCCCGAGCGCCGCCTGCATCCAGTGCCTGGACTGCCGCCTCATGTACCCGCCG
CACAAGTTCGTGGTGCACTCGCACAAGGCCCTGGAGAACCGGACCTGCCACTGGGGCTTC
GACTCGGCCAACTGGCGGGCCTACATCCTGCTGAGCCAGGATTACACGGGCAAGGAGGAG
CAGGCGCGCCTCGGCCGCTGCCTGGACGACGTGAAGGAGAAATTCGACTATGGCAACAAG
TACAAGCGGCGGGTGCCCCGGGTCTCCTCTGAGCCTCCGGCCTCCATAAGACCCAAAACA
GATGACACCTCTTCCCAGTCCCCCGCGCCTTCCGAAAAGGACAAGCCGTCCAGCTGGCTG
CGGACCTTGGCCGGCTCTTCCAATAAGAGCCTGGGCTGTGTTCACCCTCGCCAGCGCCTC
TCTGCTTTCCGACCCTGGTCCCCCGCAGTGTCAGCGAGTGAGAAAGAGCTCTCCCCACAC
CTCCCGGCCCTCATCCGAGACAGCTTCTACTCCTACAAGAGCTTTGAGACAGCCGTGGCG
CCCAACGTGGCCCTCGCACCGCCGGCCCAGCAGAAGGTTGTGAGCAGCCCTCCGTGTGCC
GCCGCCGTCTCCCGGGCCCCCGAGCCTCTCGCCACTTGCACCCAGCCTCGGAAGCGGAAG
CTGACTGTGGACACCCCAGGAGCCCCAGAGACGCTGGCGCCCGTGGCTGCCCCAGAGGAG
GACAAGGACTCGGAGGCGGAGGTGGAAGTTGAAAGCAGGGAGGAATTCACCTCCTCCTTG
TCCTCGCTCTCTTCCCCGTCCTTTACCTCATCCAGCTCCGCCAAGGACCTGGGCTCCCCG
GGTGCGCGTGCCCTGCCCTCGGCCGTCCCTGATGCTGCGGCCCCTGCCGACGCCCCCAGT
GGGCTGGAGGCGGAGCTGGAGCACCTGCGGCAGGCACTGGAGGGCGGCCTGGACACCAAG
GAAGCCAAAGAGAAGTTCCTGCATGAGGTGGTCAAGATGCGCGTGAAGCAGGAGGAGAAG
CTCAGCGCAGCCCTGCAGGCCAAGCGCAGCCTCCACCAGGAGCTGGAGTTCCTACGCGTG
GCCAAGAAGGAGAAGCTGCGGGAGGCCACGGAGGCCAAGCGTAACCTGCGGAAGGAGATC
GAGCGTCTCCGCGCCGAGAACGAGAAGAAGATGAAAGAGGCCAACGAGTCACGGCTGCGC
CTGAAGCGGGAGCTGGAGCAGGCGCGGCAGGCCCGGGTGTGCGACAAGGGCTGCGAGGCG
GGCCGCCTGCGCGCCAAGTACTCGGCCCAGATCGAAGACCTGCAGGTGAAGCTGCAGCAC
GCGGAGGCGGACCGGGAGCAGCTGCGGGCCGACCTGCTGCGGGAGCGCGAGGCCCGGGAG
CACCTGGAGAAGGTGGTGAAGGAGCTGCAGGAACAGCTGTGGCCGCGGGCCCGCCCCGAG
GCTGCGGGCAGCGAGGGCGCTGCGGAGCTGGAGCCGTAGATTCCGTGCCTGCCGCCGCAG
CGCCGCCGACAACGCGGGTGCAGGGGGGCGCGGCTGGGCGGTGCAGCTCCGCCCGGCTCC
GCCCCTGCAGCCCACACAGCACAACGTCTTACCGTGCCTATTACCAAGCGAGTGTTTGTA
ACCATGTAGTTTTGGAACCCACTGCAAAATTTTCTACTGGCCAAGTTCAAGTGAGTAAGC
CGCGTCCCCCAACTACAGCTGGAGACGGGGCCAGCTCGGCGGCCTGCTGGTCCTCTGCTT
GCTGGAACATTCTAACATTTACACTTTTGTTATAAGCTATTTAAAACCAGTAAGGAGACT
TGAAATTCAGAAAATCAACACATTTTTAAATGACTAACTTCTAAAAGCCCCAACACATGA
CGCCATCTGAAGACCCGCAACGGAGTGGGGGTGGCGGCCGCCCCACCCTCCCCACCCGGG
GAAGCCATCACAGCTCATCTGCCCGCGGCTGCGTGAGGACAGCAGGGGTTTTTCTTCAGA
GTCTATTTTTTCAGCGACAAGGACCCAGGTCTTCCTGCTGCTGCCAGGGAGAGCAGGGAC
AGTGCCGCGTGCGAGATGAGCTCGAACACTGCCCGCCTTACTGCCGCCTACCCCGCCCGC
CACGCCGCCGTCGATGCCAGCGCTGTCCCCACGGGTACCAGGAAGTGCAGAGCCGCACAG
GAGCTGCCCCGGAGCTGAGGGGACGGTCTTCGGCTCCTCTGCACCCCGTGATTCTGCCCA
CGCTCCTCCACCACGAGGCACTGACCTGCGTCGGGTGGTGACCGTGGCTGGCGGTCACGC
CCTCAGCCCCTCCGGGCACACGTGCCGCCTGACCGGGCGACCCTTTTCAGTTCGGCAAAC
GTCGCTCCCTTCATTTTGGGACTGAGGCTGCAGCATTGGAACAAAAGAGCATTATTTCAA
TTTTTCTTTCTTTTTTTTTGTTCGTTCATTTAAACGTATATTTAGAACTGCACTTTGTCC
ACAACCTTCCCTTCTCTTTCTATTCCCCAGTGAACTGAGGTTTTTACCGATTTATAGAGC
AGTCAAATCCGAAGTGCTCGAGTGCTTAGAAACCCCCTCTGGTGCTTGGTTGAACAAGGG
AATCACAAGAAAACGAAAATGCAAAAACTGAACTTCGGGGGTCGTTCTGTGCCTTCCAGC
ATCTTGTACAGCAAATCCTGACTCGTGTCTTTTTACCCCCAAGATATCTGTCTTCAGTAG
CGACTGAATCTGCCACTCTCAGAATAAGTTCCTTGCATTTATTCCAAATAATCTCGTTTA
CTCTCACCTGTTTATGCAAATTGTATAAGGTTTCTTATGCCCAAGCTTGAAAAATGATTT
CCCAGTAGACAAGAGGCGGCTACCTATCCTACAGTTACGGTATTTATTTACATAAGAAGA
TCTTACAGGAGTTCTTTGCTTGAATCCGTTCTAACACCCGCGGCAGCTGCACGCGCTCAC
AGAAGGTGGAGGTTACTTGCCCAGGTACAGACGACCTCGGGGCAGTGACGAGCAAAGACC
AGAGACTGCTGAGCCCTCGCATCTGGGTGGCGGAATTGCCTGCGGGGTTTTGCCCTTGGT
TTACTGAGGGGGGTCTTGGTTGCTGCTGAAGCCCCCCACCCCTTCTAAAGTGCAATGCAA
AAGGGACATCATGTATATGCAGCGTTTGTTTGGAATTTTCTTTGCTTTTGTTTTCTTTGC
GGTTGTTCTGTGTGCATGGATTCCACACCTCTGCCGTAGGTAGATCCGTCAGCGGGCATT
ATTACCGTGTCTTGTAAAGGGTCGGTTTTGTTATGCAACATGCAGAATGCTGTTTTTAGC
CTTGTTTTACCAGAGTTGTTTTTTTTTTCAGTTATTTCTTCAAGGGAAACTAAATGATTT
AGTTGGAGCAAAGCTTTAAGTGTGTTGGCGTGCTTCTGTGTGGCTGTCCTGTGTCGCCAG
GTCGAAGATCACAGTGAGGTAGAGGCCCTGCCCCATCCCCAGGGCCGCCAGGCTTGCTCC
GTTTGCTTTGAGTTTTTAGACCCCAGAGGGAGATGAGCTTTTCCAAGCTGTGTCTGGGCC
AGAGCCTCTCCTTGCCCTTGCTCCATCCCGACGGTCACCGTTGGGTCCACGCCTCCACCG
CCCCATCTTGCCCCAAACGGAAAGCGCTGTATCTGCAGTGGCAGCCCTTCCCCACTTCGG
CTCTGGGAGGGTCCAGCCAGTGTCACCTGGGCCCACCCTTTCCTGCAGCTGCCAGGCCCG
TGCGGTCAGTGGGACCCGGACGTGGGCAGGCGAGCTCGGGACCCTCCCAGGCAGTTCCCA
CAGCTCTTGCCTCGGCTCACCAGGGTCACTTCCACTGTCAGGGGCCTGAGGGGGCAGCTG
TGGCTGCAGGGCTGCTCTGGACTGAGGGGTCCCAGGCCCCGAGGGGTGCACGCCTGGCTC
CCCTTGGCACAGGTGCGAGTCCGTTTCTTTTCAGCAGAAGGGGGAAGAGGTGTCCGCTGT
GTGGGCTGCTGACTCCTCTGTGTGTGAGGCCCTTCATCTAAGTGATTGTGTATTCAGTTT
AATTCTCATTATATTTCTATACTGAAAGAAGATTTTTAACGAAGGGAAAAACAACAGCAA
TAACATTCATATCTCTGGAGCAGCTAACTCATACACGTAATGTCTGCTTTTCGTACAGAA
CTAGCCAATGTAAAAACAGTTCACCTGTAAATACTTTTTCCTTTTTCACCGTTGTATTAT
ACATGTATATGCTGGGTCCTTTTTCAGAAACTCTTTTCTTACCTGAGAGTTGTCTTGTTT
TCTGGGCTGTTTTTAACTGAGGAAAAAAAAAATGCTTTCCTGCCGGGGGGCAGGGGAGAC
GGAGAAACCCATGTGCGTTTCCCATGTGACCCCCTCCTCCCTGTGGGTCTGAGCCCCGGC
CCCCCCCACCTCCTCCTCCCTGTGGGTCCGAACCCCGGCCCCCCCACCCCCTCCTCCCTG
TGGGTCCGAACCCCGGCCCCCCCACCCCCTCCTCCCTGTGGGTCCGATCCCCGGCCCCCC
CCACCCCCTCCTCCCTGTGGGTCCGAACCCCGGCCCCCCCCCCACCCCCTCCTCCCTGTG
GGTCCGAACCCCGGCCCCCCCACCCCTCCCTCAGCCCACCAGGGTCCAGGGAGATGTTCG
TTCTCGCTTTAAGTCAGGAGTCACAAATGACTTTTTTTTTTCAATTAAGGAAAAAGCTCC
ATCTCTACCTTTAACATCACCCAGACCCCCGCCCCTGCCCGTGCCCCACGCTGCTGCTAA
CGACAGTATGATGCTTACTCTGCTACTCGGAAACTATTTTTATGTAATTAATGTATGCTT
TCTTGTTTATAAATGCCTGATTTAAAAAGAAAAGAGCTTGGCATATTTATCTATTTCGCT
GTGTACCTGTTAGTCCTTCCCCGACCCCGAAACAGATGACATTGTACAATAAAGGACTTT
GAGAGGA

Protein Sequence

>6497 : length: 730
MEAAAGGRGCFQPHPGLQKTLEQFHLSSMSSLGGPAAFSARWAQEAYKKESAKEAGAAAV
PAPVPAATEPPPVLHLPAIQPPPPVLPGPFFMPSDRSTERCETVLEGETISCFVVGGEKR
LCLPQILNSVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKT
DAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSP
SAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSANWRAYILLSQDYTGKEEQARL
GRCLDDVKEKFDYGNKYKRRVPRVSSEPPASIRPKTDDTSSQSPAPSEKDKPSSWLRTLA
GSSNKSLGCVHPRQRLSAFRPWSPAVSASEKELSPHLPALIRDSFYSYKSFETAVAPNVA
LAPPAQQKVVSSPPCAAAVSRAPEPLATCTQPRKRKLTVDTPGAPETLAPVAAPEEDKDS
EAEVEVESREECTFTSSLSSLSSPSFTSSSSAKDLGSPGARALPSAVPDAAAPADAPSGL
EAELEHLRQALEGGLDTKEAKEKFLHEVVKMRVKQEEKLSAALQAKRSLHQELEFLRVAK
KEKLREATEAKRNLRKEIERLRAENEKKMKEANESRLRLKRELEQARQARVCDKGCEAGR
LRAKYSAQIEDLQVKLQHAEADREQLRADLLREREAREHLEKVVKELQEQLWPRARPEAA
GSEGAAELEP