ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6495

Name

SIX1

Synonym

BOS3|DFNA23|TIP39;SIX homeobox 1;SIX1;SIX homeobox 1

Definition

homeobox protein SIX1|sine oculis homeobox homolog 1

Position

14q23.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

6495

Links to epithelial mesenchymal transition gene database

6495

Links to ovarian cancer gene database

6495

Links to endometrial cancer gene database

6495

Links to iHOP

6495

Sequence Information

Nucleotide Sequence

>6495 : length: 2687
CGGAGGCAGCAAGGCCTTAAAGGCTACTGAGTGCGCCGGCCGTTCCGTGTCCAGAACCTC
CCCTACTCCTCCGCCTTCTCTTCCTTGGCCGCCCACCGCCAAGTTCCGACTCCGGTTTTC
GCCTTTGCAAAGCCTAAGGAGGAGGTTAGGAACAGCCGCGCCCCCCTCCCTGCGGCCGCC
GCCCCCTGCCTCTCGGCTCTGCTCCCTGCCGCGTGCGCCTGGGCCGTGCGCCCCGGCAGG
CCCCAGCCATGTCGATGCTGCCGTCGTTTGGCTTTACGCAGGAGCAAGTGGCGTGCGTGT
GCGAGGTTCTGCAGCAAGGCGGAAACCTGGAGCGCCTGGGCAGGTTCCTGTGGTCACTGC
CCGCCTGCGACCACCTGCACAAGAACGAGAGCGTACTCAAGGCCAAGGCGGTGGTCGCCT
TCCACCGCGGCAACTTCCGTGAGCTCTACAAGATCCTGGAGAGCCACCAGTTCTCGCCTC
ACAACCACCCCAAACTGCAGCAACTGTGGCTGAAGGCGCATTACGTGGAGGCCGAGAAGC
TGCGCGGCCGACCCCTGGGCGCCGTGGGCAAATATCGGGTGCGCCGAAAATTTCCACTGC
CGCGCACCATCTGGGACGGCGAGGAGACCAGCTACTGCTTCAAGGAGAAGTCGAGGGGTG
TCCTGCGGGAGTGGTACGCGCACAATCCCTACCCATCGCCGCGTGAGAAGCGGGAGCTGG
CCGAGGCCACCGGCCTCACCACCACCCAGGTCAGCAACTGGTTTAAGAACCGGAGGCAAA
GAGACCGGGCCGCGGAGGCCAAGGAAAGGGAGAACACCGAAAACAATAACTCCTCCTCCA
ACAAGCAGAACCAACTCTCTCCTCTGGAAGGGGGCAAGCCGCTCATGTCCAGCTCAGAAG
AGGAATTCTCACCTCCCCAAAGTCCAGACCAGAACTCGGTCCTTCTGCTGCAGGGCAATA
TGGGCCACGCCAGGAGCTCAAACTATTCTCTCCCGGGCTTAACAGCCTCGCAGCCCAGTC
ACGGCCTGCAGACCCACCAGCATCAGCTCCAAGACTCTCTGCTCGGCCCCCTCACCTCCA
GTCTGGTGGACTTGGGGTCCTAAGTGGGGAGGGACTGGGGCCTCGAAGGGATTCCTGGAG
CAGCAACCACTGCAGCGACTAGGGACACTTGTAAATAGAAATCAGGAACATTTTTGCAGC
TTGTTTCTGGAGTTGTTTGCGCATAAAGGAATGGTGGACTTTCACAAATATCTTTTTAAA
AATCAAAACCAACAGCGATCTCAAGCTTAATCTCCTCTTCTCTCCAACTCTTTCCACTTT
TGCATTTTCCTTCCCAATGCAGAGATCAGGGAAAAAAAAAAAAAAAAACCCAAACAAACA
AAAGCACCCAGGCACCCAGTCTGAGTTCTGGGCAACTGATACGCCTGTTTCAGCAGCCTT
TCTTTTTTTTCAATGAATGGGAATTGCAAATCAACTGGATTTTCATTATTTCCTTTTAAT
TTATATATGGAGAAATGTGAAGAGGGAAAGGAAATGGAAAGAGAAAGAGAAAGGGAGATA
AAAATAGTGAAAATAAGAGCCTCCAGGCTCAGAAGAACTGATTACATTCTTAAGGTGAAC
AGGAAAAATACAATCTATAACTTTCTTTGATGAGGAAAAATTAAGTTTACATTTTTCATA
TTTAGTGTTAAACAATTTAATGTAGATTAAAATAAAAGACCAGTATTAGGAGGAAAAAAC
AAGTGCCTAAATGTCTTAATGCTCTCTATGTGAGACAGAAATAGACGTGACCATTAGTAA
TGCAACTATTTTTGTCAAATTTAGTGGGATTTTTTGGTTGTTGTTTGTTTTCTTGGGTTT
TTTTTTTTTAAATGACAAACTCTAAAAATGTACCAATGTGAAAAAACACTTTCCTGAATG
CCATTACTCATGCCCTCAAAGCTTTCATATCTGTAGCCTACTCCTGTAAAGGGTTTCTCC
TGTTTCTAGTTTCTAGTTTGCAAAGGTATGCCAACGAATCTGGCAACCTGGTATTTGTTA
CTAAAACAGCATGTGTTTTCAGGTTTCTTTTCTATTGTACCTAAAGCAGTCTAAATTAAA
ACTTAGTAGAACACCAGGAGTATGATTCTGTTTCTGAAAGGTGAGTGGTGTATTGCTGTC
ATTGGGCCCTATTTTTTTTTTTAAATATATTTTTCTTTCTTACTTAATGGTGGCTGTGAA
TTGCAGGGTACTTTGAAGGCCATCATCTGAACCAAGAGTAGTAACTAGATTAATTATATG
ACAGAAAGAGTGAATTTAGCCTTGGGGTATTTATTAACTTCTATTATTTAGATATGCAAT
TTTGTTTACCACTATCTCTTCACAGCATTCATATGTTAACTAAGCTCTTTTGTGTTAACA
AGTTTATGACAAGACTGTGAAAGTAAAAATAATTTATCTGCTTGAAGACAAAAAAGGGAA
GGAGAACAAGGATAGAAACATTGTGAATTAATTTGTACAAATAGAAAGCAGACCAGCAGG
ACAGGAGCTCTTTTGCAGTGCTGCCGGATGGTGTCTAGAAAAATCCCAGTAATCATGTAG
GCTCCATATTATTTTTGCCTGGGGCAAAATGATGTATCTTCTGTATTTAGCTTTTAAAAT
TAGTGAAACAAATGGCATTATTTATTAAAATTCTACTCAGGATAACA

Protein Sequence

>6495 : length: 284
MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHR
GNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRT
IWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDR
AAEAKERENTENNNSSSNKQNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGH
ARSSNYSLPGLTASQPSHGLQTHQHQLQDSLLGPLTSSLVDLGS