ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

64919

Name

BCL11B

Synonym

ATL1|ATL1-alpha|ATL1-beta|ATL1-delta|ATL1-gamma|CTIP-2|CTIP2|RIT1|ZNF856B|hRIT1-alpha;B-cell CLL/lymphoma 11B (zinc finger protein);BCL11B;B-cell CLL/lymphoma 11B (zinc finger protein)

Definition

B-cell CLL/lymphoma 11B/T-cell receptor delta constant region fusion protein|B-cell lymphoma/leukaemia 11B|B-cell lymphoma/leukemia 11B|BCL-11B|BCL11B/TRDC fusion|COUP-TF-interacting protein 2|hRit1|radiation-induced tumor suppressor gene 1 protein|zinc f

Position

14q32.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

64919

Links to epithelial mesenchymal transition gene database

64919

Links to ovarian cancer gene database

64919

Links to endometrial cancer gene database

64919

Links to iHOP

64919

Sequence Information

Nucleotide Sequence

>64919 : length: 8044
TGCGCTTTCCACCTACCAGACCCTGAAAGAAAGTGTCAGGAGCCGGTGCAAAACCCAGTT
TAAGTTCAAGAAGACATTTGCAAGTGCAAGAGGCCAAGCAGTTTGAAGAAGTGTAAGAGA
TTTTTTTTCCTTCGAAAGAATATATTTTTAAAGAAACCAGCCAGTCCGCGGAAAGCAACA
GCAGTTTTTTTTTTTTTTGCCTCTTTTTCTTATTTTAGATCGAGAGGTTTTTCTTGCTTT
TCTTCCCTTTTTTTTCTTTTTGCAAACAAAACAAAAAACAGCATAGAAGAAAGAGCAAAA
TAAAGAAGAAGAAGAGGAGGAAGAGAGGGAAAGAGAGGAAGGGAAAAAAAACACCAACCC
GGGCAGAGGAGGAGGTGCGGCGGCGGCGGCGGCGGCGGCAGCGGCGGCAGCGGCGCGGCG
GCGGCTCGGACCCCCTCCCCCGGCTCCCCCCATCAGTGCAGCTCTCCGGGCGATGCCAGA
ATAGATGCCGGGGCAATGTCCCGCCGCAAACAGGGCAACCCGCAGCACTTGTCCCAGAGG
GAGCTCATCACCCCAGAGGCTGACCATGTGGAGGCCGCCATCCTCGAAGAAGACGAGGGT
CTGGAGATAGAGGAGCCAAGTGGCCTGGGGCTGATGGTGGGTGGCCCCGACCCTGACCTG
CTCACCTGTGGCCAGTGTCAAATGAACTTCCCCTTGGGGGACATCCTGGTTTTTATAGAG
CACAAAAGGAAGCAGTGTGGCGGCAGCTTGGGTGCCTGCTATGACAAGGCCCTGGACAAG
GACAGCCCGCCACCCTCCTCACGCTCCGAGCTCAGGAAAGTGTCCGAGCCGGTGGAGATC
GGGATCCAAGTCACCCCCGACGAAGATGACCACCTGCTCTCACCCACGAAAGGCATCTGT
CCCAAGCAGGAGAACATTGCAGGGCCGTGCAGGCCTGCCCAGCTGCCAGCGGTGGCCCCC
ATAGCTGCCTCCTCCCACCCTCACTCATCCGTGATCACTTCACCTCTGCGTGCCCTGGGC
GCTCTCCCGCCCTGCCTCCCCCTGCCGTGCTGCAGCGCGCGCCCGGTCTCGGGTGACGGG
ACTCAGGGTGAGGGTCAGACGGAGGCTCCCTTTGGATGCCAGTGTCAGTTGTCAGGTAAA
GATGAGCCTTCCAGCTACATTTGCACAACATGCAAGCAGCCCTTCAACAGCGCGTGGTTC
CTGCTGCAGCACGCGCAGAACACGCACGGCTTCCGCATCTACCTGGAGCCCGGGCCGGCC
AGCAGCTCGCTCACGCCGCGGCTCACCATCCCGCCGCCGCTCGGGCCGGAGGCCGTGGCG
CAGTCCCCGCTCATGAATTTCCTGGGCGACAGCAACCCCTTCAACCTGCTGCGCATGACG
GGCCCCATCCTGCGGGACCACCCGGGCTTCGGCGAGGGCCGCCTGCCGGGCACGCCGCCT
CTCTTCAGTCCCCCGCCGCGCCACCACCTGGACCCGCACCGCCTCAGTGCCGAGGAGATG
GGGCTCGTCGCCCAGCACCCCAGTGCCTTCGACCGAGTCATGCGCCTGAACCCCATGGCC
ATCGACTCGCCCGCCATGGACTTCTCGCGGCGGCTCCGCGAGCTGGCGGGCAACAGCTCC
ACGCCGCCGCCCGTGTCCCCGGGCCGCGGCAACCCTATGCACCGGCTCCTGAACCCCTTC
CAGCCCAGCCCCAAGTCCCCGTTCCTGAGCACGCCGCCGCTGCCGCCCATGCCCCCTGGC
GGCACGCCGCCCCCGCAGCCGCCAGCCAAGAGCAAGTCGTGCGAGTTCTGCGGCAAGACC
TTCAAGTTCCAGAGCAATCTCATCGTGCACCGGCGCAGTCACACGGGCGAGAAGCCCTAC
AAGTGCCAGCTGTGCGACCACGCGTGCTCGCAGGCCAGCAAGCTCAAGCGCCACATGAAG
ACGCACATGCACAAGGCCGGCTCGCTGGCCGGCCGCTCCGACGACGGGCTCTCGGCCGCC
AGCTCCCCCGAGCCCGGCACCAGCGAGCTGGCGGGCGAGGGCCTCAAGGCGGCCGACGGT
GACTTCCGCCACCACGAGAGCGACCCGTCGCTGGGCCACGAGCCGGAGGAGGAGGACGAG
GAGGAGGAGGAGGAGGAGGAGGAGCTGCTACTGGAGAACGAGAGCCGGCCCGAGTCGAGC
TTCAGCATGGACTCGGAGCTGAGCCGCAACCGCGAGAACGGCGGTGGTGGGGTGCCCGGG
GTCCCGGGCGCGGGGGGCGGCGCGGCCAAGGCGCTGGCTGACGAGAAGGCGCTGGTGCTG
GGCAAGGTCATGGAGAACGTGGGCCTAGGCGCACTGCCGCAGTACGGCGAGCTCCTGGCC
GACAAGCAGAAGCGCGGCGCCTTCCTGAAGCGTGCGGCGGGCGGCGGGGACGCGGGCGAC
GACGACGACGCGGGCGGCTGCGGGGACGCGGGCGCGGGCGGCGCGGTCAACGGGCGCGGG
GGCGGCTTCGCGCCAGGCACCGAGCCCTTCCCCGGGCTCTTCCCGCGCAAGCCCGCGCCG
CTGCCCAGCCCCGGGCTCAACAGCGCCGCCAAGCGCATCAAGGTGGAGAAGGACCTGGAG
CTGCCGCCCGCCGCGCTCATCCCGTCCGAGAACGTGTACTCGCAGTGGCTGGTGGGCTAC
GCGGCGTCGCGGCACTTCATGAAGGACCCCTTCCTGGGCTTCACGGACGCACGACAGTCG
CCCTTCGCCACGTCGTCCGAGCACTCGTCCGAGAACGGCAGCCTGCGCTTCTCCACGCCG
CCCGGGGACCTGCTGGACGGCGGCCTCTCGGGCCGCAGCGGCACGGCCAGCGGAGGCAGC
ACCCCGCACCTGGGCGGCCCGGGCCCCGGGCGGCCCAGCTCCAAGGAGGGCCGCCGCAGC
GACACGTGCGAGTACTGCGGCAAGGTGTTCAAGAACTGCAGCAACTTGACGGTGCACCGG
CGGAGCCACACCGGCGAGCGGCCTTACAAGTGCGAGCTGTGCAACTACGCGTGCGCGCAG
AGCAGCAAGCTCACGCGCCACATGAAGACGCACGGGCAGATCGGCAAGGAGGTGTACCGC
TGCGACATCTGCCAGATGCCCTTCAGCGTCTACAGCACCCTGGAGAAACACATGAAAAAG
TGGCACGGCGAGCACTTGCTGACTAACGACGTCAAAATCGAGCAGGCCGAGAGGAGCTAA
GCGCGCGGGCCCCGGCGCCCCGCACCTGTACAGTGGAACCGTTGCCAACCGAGAGAATGC
TGACCTGACTTGCCTCCGTGTCACCGCCACCCCGCACCCCGCGTGTCCCCGGGGCCCAGG
GGAGGCGGCACTCCAACCTAACCTGTGTCTGCGAAGTCCTATGGAAACCCGAGGGTTGAT
TAAGGCAGTACAAATTGTGGAGCCTTTTAACTGTGCAATAATTTCTGTATTTATTGGGTT
TTGTAATTTTTTTGGCATGTGCAGGTACTTTTTATTATTATTTTTTCTGTTTGAATTCCT
TTAAGAGATTTTGTTGGGTATCCATCCCTTCTTTGTTTTTTTTTTAACCCGGTAGTAGCC
TGAGCAATGACTCGCAAGCAATGTTAGAGGGGAAGCATATCTTTTAAATTATAATTTGGG
GGGAGGGGTGGTGCTGCTTTTTTGAAATTTAAGCTAAGCATGTGTAATTTCTTGTGAAGA
AGCCAACACTCAAATGACTTTTAAAGTTGTTTACTTTTTCATTCCTTCCTTTTTTTTGTC
CTGAAATAAAAAGTGGCATGCAGTTTTTTTTTTAATTATTTTTTAATTTTTTTTTTGGTT
TTTGTTTTTGGGGTGGGGGGTGTGGATGTACAGCGGATAACAATCTTTCAAGTCGTAGCA
CTTTGTTTCAGAACTGGAATGGAGATGTAGCACTCATGTCGTCCCGAGTCAAGCGGCCTT
TTCTGTGTTGATTTCGGCTTTCATATTACATAAGGGAAACCTTGAGTGGTGGTGCTGGGG
GAGGCACCCCACAGACTCAGCGCCGCCAGAGATAGGGTTTTTGGAGGGCTCCTCTGGGAA
ATGGCCCGACAGCATTCTGAGGTTGTGCATGACCAGCAGATACTATCCTGTTGGTGTGCC
CTGGGGTGCCATGGCTGCTATTCGCTGTAGATTAGGCTACATAAAATGGGCTGAGGGTAC
CTTTTTGGGGAGATGGGGTGGCCTGCAGTGACACAGAAAGGAAGAAACTAGCGGTGTTCT
TTTAGGCGTTTTCTGGCTTGACGGCTTCTCTCTTTTTTTAAATCACCCCCACCACATAAA
TCTCAAATCCTATGTTGCTACAAGGGGTCATCCATCATTTCCCAAGCAGACGAATGCCCT
AATTAATTGAAGTTAGTGTTCTCTCATTTAATGCACACTGATGATATTGTAGGGATGGGT
GGGGTGGGGATCTTGCAAATTTCTATTCTCTTTTACTGAAAAAGCAGGGGATGAGTTCCA
TCAGAAGGTGCCCAGCGCTACTTCCCAGGTTTTTATTTTTTTTTTCCTATCTCATTAGGT
TGGAAGGTACTAAATATTGAACTGTTAAGATTAGACATTTGAATTCTGTTGACCCGCACT
TTAAAGCTTTTGTTTGCATTTAAATTAAATGGCTTCTAAACAAGAAATTGCAGCATATTC
TTCTCTTTGGCCCAGAGGTGGGTTAAACTGTAAGGGACAGCTGAGATTGAGTGTCAGTAT
TGCTAAGCGTGGCATTCACAATACTGGCACTATAAAGAACAAAATAAAATAATAATTTAT
AGGACAGTTTTTCTACTGCCATTCAATTTGATGTGAGTGCCTTGAAAACTGATCTTCCTA
TTTGAGTCTCTTGAGACAAATGCAAAACTTTTTTTTTGAAATGAAAAGACTTTTTAAAAA
AGTAAAACAAGAAAAGTACATTCTTTAGAAACTAACAAAGCCACATTTACTTTAAGTAAA
AAAAAAAAAAATTCTGGTTGAAGATAGAGGATATGAAATGCCATAAGACCCAATCAAATG
AAGAAATAAACCCAGCACAACCTTGGACATCCATTAGCTGAATTATCCTCAGCCCCTTTT
GTTTTTGGGACAACGCTGCTTAGATATGGAGTGGAGGTGATTTACTGCTGAATTAAAACT
CAAGTGACACAAGTTACAAGTTGATATCGTTGAATGAAAAGCAAAACAAAAACAATTCAG
GAACAACGGCTAATTTTTTCTAAAGTTAAATTTAGTGCACTCTGTCTTAAAAATACGTTT
ACAGTATTGGGTACATACAAGGGTAAAAAAAAAATTGTGTGTATGTGTGTTGGAGCGATC
TTTTTTTTTCAAAGTTTGCTTAATAGGTTATACAAAAATGCCACAGTGGCCGCGTGTATA
TTGTTTTCTTTTGGTGACGGGGTTTTAGTATATATTATATATATTAAAATTTCTTGATTA
CTGTAAAAGTGGACCAGTATTTGTAATAATCGAGAATGCCTGGGCATTTTACAAAACAAG
AAAAAAAATACCCTTTTCTTTTCCTTGAAAATGTTGCAGTAAAATTTAAATGGTGGGTCT
ATAAATTTGTTCTTGTTACAGTAACTGTAAAGTCGGAGTTTTAGTAAATTTTTTTCTGCC
TTGGGTGTTGAATTTTTATTTCAAAAAAAATGTATAGAAACTTGTATTTGGGGATTCAAA
GGGGATTGCTACACCATGTAGAAAAAGTATGTAGAAAAAAAGTGCTTAATATTGTTATTG
CTTTGCAGAAAAAAAAAAAATCACATTTCTGACCTGTACTTATTTTTCTCTTCCCGCCTC
CCTCTGGAATGGATATATTGGTTGGTTCATATGATGTAGGCACTTGCTGTATTTTTACTG
GAGCTCGTAATTTTTTAACTGTAAGCTTGTCCTTTTAAAGGGATTTAATGTACCTTTTTG
TTAGTGAATTTGGAAATAAAAAGAAAAAAAAAACAAAAACAAACAGGCTGCCATAATATA
TTTTTTTAATTTGGCAGGATAAAATATTGCAAAAAAAACACATTTGTATGTTAAGTCCTA
TTGTACAGGAGAAAAAGGGTTGTTTGACAACCTTTGAGAAAAAGAAACAAAAGGAAGTAG
TTAAATGCTTTGGTTCACAAATCATTTAGTTGTATATATTTTTTGTCGGAATTGGCCTAC
ACAGAGAACCGTTCGTGTTGGGCTTCTCTCTGAACGCCCCGAACCTTGCATCAAGGCTCC
TTGGTGTGGCCACAGCAGACCAGATGGGAAATTATTTGTGTTGAGTGGAAAAAAATCAGT
TTTTGTAAAGATGTCAGTAACATTCCACATCGTCCTCCCTTTCTCTAAGAGGCCATCTCT
AAGATGTCAGATGTAGAGGAGAGAGAGCGAGAGAACATCTTCCTTCTCTACCATCACTCC
TGTGGCGGTCACCACCACCACCTCTCCCGCCCTTACCAGCAGAAAGCAATGCAAACTGAG
CTGCTTTAGTCCTTGAGAAATTGTGAAACAAACACAAATATCATAAAAGGAGCTGGTGAT
TCAGCTGGGTCCAGGTGAAGTGACCTGCTGTTGAGACCGGTACAAATTGGATTTCAGGAA
GGAGACTCCATCACAGCCAGGACCTTTCGTGCCATGGAGAGTGTTGGCCTCTTGTCTTTC
TTCCCTGCTTTGCTGCTTTGCTCTCTGAAACCTACATTCCGTCAGTTTCCGAATGCGAGG
GCCTGGGATGAATTTGGTGCCTTTCCATATCTCGTTCTCTCTCCTTCCCCTGCGTTTCCT
CTCCATCCTTCATCCTCCATTGGTCCTTTTTTTTTCTTTCATTTTTTATTTAATTTCTTT
TCTTCCTGTCTGTTCCTCCCCTAATCCTCTATTTTATTTTTATTTTTTGTAAAGCCAAGT
AGCTTTAAGATAAAGTGGTGGTCTTTTGGATGAGGGAATAATGCATTTTTAAATAAAATA
CCAATATCAGGAAGCCATTTTTTATTTCAGGAAATGTAAGAAACCATTATTTCAGGTTAT
GAAAGTATAACCAAGCATCCTTTTGGGCAATTCCTTACCAAATGCAGAAGCTTTTCTGTT
CGATGCACTCTTTCCTCCTTGCCACTTACCTTTGCAAAGTTAAAAAAAAGGGGGGAGGGA
ATGGGAGAGAAAGCTGAGATTTCAGTTTCCTACTGCAGTTTCCTACCTGCAGATCCAGGG
GCTGCTGTTGCCTTTGGATGCCCCACTGAGGTCCTAGAGTGCCTCCAGGGTGGTCTTCCT
GTAGTCATAACAGCTAGCCAGTGCTCACCAGCTTACCAGATTGCCAGGACTAAGCCATCC
CAAAGCACAAGCATTGTGTGTCTCTGTGACTGCAGAGAAGAGAGAATTTTGCTTCTGTTT
TGTGTTTAAAAAACCAACACGGAAGCAGATGATCCCGAGAGAGAGGCCTCTAGCATGGGT
GACCCAGCCGACCTCAGGCCGGTTTCCGCACTGCCACAACTTTGTTCAAAGTTGCCCCCA
ATTGGAACCTGCCACTTGGCATTAGAGGGTCTTTCATGGGGAGAGAAGGAGACTGAATTA
CTCTAAGCAAAATGTGAAAAGTAAGGAAATCAGCCTTTCATCCCGGTCCTAAGTAACCGT
CAGCCGAAGGTCTCGTGGAACACAGGCAAACCCGTGATTTTGGTGCTCCTTGTAACTCAG
CCCTGCAAAGCAAAGTCCCATTGATTTAAGTTGTTTGCATTTGTACTGGCAAGGCAAAAT
ATTTTTATTACCTTTTCTATTACTTATTGTATGAGCTTTTGTTGTTTACTTGGAGGTTTT
GTCTTTTACTACAAGTTTGGAACTATTTATTATTGCTTGGTATTTGTGCTCTGTTTAAGA
AACAGGCACTTTTTTTTATTATGGATAAAATGTTGAGATGACAGGAGGTCATTTCAATAT
GGCTTAGTAAAATATTTATTGTTCCTTTATTCTCTGTACAAGATTTTGGGCCTCTTTTTT
TCCTTAATGTCACAATGTTGAGTTCAGCATGTGTCTGCCATTTCATTTGTACGCTTGTTC
AAAACCAAGTTTGTTCTGGTTTCAAGTTATAAAAATAAATTGGACATTTAACTTGATCTC
CAAA

Protein Sequence

>64919 : length: 894
MSRRKQGNPQHLSQRELITPEADHVEAAILEEDEGLEIEEPSGLGLMVGGPDPDLLTCGQ
CQMNFPLGDILVFIEHKRKQCGGSLGACYDKALDKDSPPPSSRSELRKVSEPVEIGIQVT
PDEDDHLLSPTKGICPKQENIAGPCRPAQLPAVAPIAASSHPHSSVITSPLRALGALPPC
LPLPCCSARPVSGDGTQGEGQTEAPFGCQCQLSGKDEPSSYICTTCKQPFNSAWFLLQHA
QNTHGFRIYLEPGPASSSLTPRLTIPPPLGPEAVAQSPLMNFLGDSNPFNLLRMTGPILR
DHPGFGEGRLPGTPPLFSPPPRHHLDPHRLSAEEMGLVAQHPSAFDRVMRLNPMAIDSPA
MDFSRRLRELAGNSSTPPPVSPGRGNPMHRLLNPFQPSPKSPFLSTPPLPPMPPGGTPPP
QPPAKSKSCEFCGKTFKFQSNLIVHRRSHTGEKPYKCQLCDHACSQASKLKRHMKTHMHK
AGSLAGRSDDGLSAASSPEPGTSELAGEGLKAADGDFRHHESDPSLGHEPEEEDEEEEEE
EEELLLENESRPESSFSMDSELSRNRENGGGGVPGVPGAGGGAAKALADEKALVLGKVME
NVGLGALPQYGELLADKQKRGAFLKRAAGGGDAGDDDDAGGCGDAGAGGAVNGRGGGFAP
GTEPFPGLFPRKPAPLPSPGLNSAAKRIKVEKDLELPPAALIPSENVYSQWLVGYAASRH
FMKDPFLGFTDARQSPFATSSEHSSENGSLRFSTPPGDLLDGGLSGRSGTASGGSTPHLG
GPGPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLT
RHMKTHGQIGKEVYRCDICQMPFSVYSTLEKHMKKWHGEHLLTNDVKIEQAERS