ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6491

Name

STIL

Synonym

MCPH7|SIL;SCL/TAL1 interrupting locus;STIL;SCL/TAL1 interrupting locus

Definition

SCL-interrupting locus protein|TAL-1-interrupting locus protein

Position

1p32

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by the Hedgehog family;PID Curated;200144

Disease

Microcephaly, primary autosomal recessive, 7;OMIM

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

6491

Links to epithelial mesenchymal transition gene database

6491

Links to ovarian cancer gene database

6491

Links to endometrial cancer gene database

6491

Links to iHOP

6491

Sequence Information

Nucleotide Sequence

>6491 : length: 5753
CGCACTCCAGCTTGGGCGACGGAGTGAGATTCCACCTCAAAAAAAAAAAAAATTATGTCA
CTAAAACAGATGGCTTCCTAGGAAAGAAACTGGAAGAAATCTAGAAGTTGAGGATAAGTG
ATCACAAAAAGGAAAAATTAAAAATGTACATTTTAGAATAAAAATTAAAAAGTAAGAAAC
TGGAATAACTCTAACTTTCTTGTCTTTTGTGCTTTCAGGTAAAGAGTTTGGAAACTGTTC
TTCGGGTGTCCGCTTCCAGTCGCCGACCAATGATCATCTTATAGAGCACTTCCGGCTTCA
TCTGCCACTCGCTCCTCCGTCTACCTAGCTGGGCTTTCCATTGCGCTTGCGGAAAGCCTA
CCCCGCCCCGGAACTTAACCGTTGACGAAATGAAAGGTTTAAATCCTCGGATCCTTGATC
CTGGAGCGCCGGTGGCGCCCGCAGTTCTCCAAGAAGACTTGGGATTGGTCGAGCGCGGAA
CCAGTGCGGGGCGCTGATTGGTCGGCACACCAATACGTAACGGCGACCGTGCGCGGCTCT
CTAGCACCACCCCCGCTCCCTGACTGGCGAGGTTTCTGACCAGTCAGCAGGCGTGGCGCG
GCCTTCAGTTTCGCGAGCTTGTGTTTGCCGCCTCAGTTCCCGCGACCCCAACGTCCCAGA
GGCGGGGCCGGAGTCGGCGGTGGCGCTCCTTGGAGCCGGCTCCCGCTCCTACCCTGCAAA
CAGACCTCAGCTCCGCGGAAGTTGCGTGGGTTCCGCCCTCCAGGAGCCTGGAGCAGATGA
CGAGAAGGGGAGCTAGTGGGAGAAATTAAGCAGTCCATGAAATCCTTGGGTATCATCTGA
GCTAAGGATACTGAGGATTTGGAATTAAAGAAATCATTCACCAGACATCATGGAGCCTAT
ATATCCTTTTGCACGGCCCCAGATGAATACCAGGTTTCCTTCAAGCAGGATGGTACCTTT
CCACTTTCCTCCATCAAAATGTGCACTTTGGAACCCAACGCCAACTGGAGATTTCATCTA
CTTACATCTCAGTTACTACAGAAATCCAAAGCTTGTGGTGACTGAGAAGACCATCCGACT
TGCTTATCGTCATGCTAAGCAGAATAAAAAAAATTCGTCATGCTTTTTACTTGGTTCTCT
GACAGCAGACGAAGATGAAGAAGGTGTAACATTGACAGTAGATCGCTTTGATCCTGGTCG
AGAAGTACCTGAATGCCTAGAAATAACCCCTACTGCTTCTCTTCCTGGGGACTTTTTGAT
TCCATGCAAAGTTCATACTCAAGAACTTTGTTCAAGAGAAATGATAGTTCACAGTGTAGA
TGACTTCAGTTCAGCTTTAAAGGCTCTACAGTGCCATATATGTAGCAAAGATTCCTTGGA
CTGTGGTAAGCTGCTTTCCCTAAGAGTTCATATCACTTCCAGGGAGAGTTTGGACAGTGT
GGAATTTGACTTGCATTGGGCAGCAGTAACTCTAGCAAATAACTTTAAATGCACACCTGT
GAAGCCCATCCCCATTATTCCAACAGCTCTGGCAAGAAACTTGAGCAGTAATCTGAATAT
TTCTCAAGTTCAAGGGACTTATAAATATGGATATCTTACCATGGATGAAACACGCAAATT
GTTACTTTTGTTGGAATCTGATCCCAAGGTTTATTCTCTACCATTGGTGGGAATTTGGCT
GTCTGGAATTACACATATCTATAGTCCTCAGGTATGGGCTTGCTGTTTGCGATACATATT
CAATTCTTCTGTTCAAGAAAGGGTTTTTTCAGAATCTGGAAATTTCATCATAGTTCTCTA
TTCTATGACACATAAGGAACCTGAGTTTTATGAATGCTTCCCTTGTGATGGCAAGATACC
TGACTTTCGGTTTCAGTTGCTAACCAGTAAGGAAACATTACATCTTTTCAAAAATGTTGA
ACCTCCTGACAAAAATCCAATCCGTTGTGAACTGAGCGCTGAAAGCCAAAATGCAGAAAC
AGAGTTTTTCAGTAAGGCTTCCAAGAATTTTTCAATTAAGAGGTCTTCCCAAAAGTTATC
TTCTGGGAAGATGCCAATACATGATCACGACTCTGGTGTTGAAGATGAAGATTTTTCTCC
AAGACCAATTCCTAGTCCTCATCCAGTGAGTCAGAAGATTTCTAAGATCCAACCATCAGT
TCCTGAACTTTCACTTGTGTTGGATGGCAATTTCATAGAATCAAACCCTCTGCCTACTCC
ATTGGAAATGGTGAATAATGAAAATCCTCCTTTGATTAACCACTTGGAACACTTGAAGCC
ATTGCAACCCCAGCTTTATGATGAGAAACACAGTCCAGAAGTTGAAGCTGGAGAGCCTTC
CTTGAGAGGAATACCAAATCAGTTAAACCAGGATAAACCAGCTCTTTTGAGACACTGCAA
AGTAAGACAGCCACCTGCCTATAAGAAAGGGAACCCCCATACCAGGAACAGTATTAAACC
ATCTTCTCATAATGGGCCATCTCATGATATATTTGAAAAGCTCCAAACAGTTTCTGCTGG
AAATGTACAAAACGAAGAGTATCCTATAAGACCCTCCACACTTAATTCTAGGCAGTCTTC
TCTTGCCCCGCAGTCCCAACCACACGATTTTGTTTTTTCACCCCATAATTCAGGAAGACC
AATGGAACTTCAGATACCTACTCCCCCACTGCCATCTTACTGTTCCACAAACGTTTGCAG
GTGTTGTCAGCATCATAGTCATATTCAATATAGTCCGCTAAATTCTTGGCAAGGAGCAAA
CACAGTTGGATCCATTCAAGATGTCCAGTCTGAAGCCCTTCAAAAGCATTCATTATTTCA
CCCAAGTGGATGTCCAGCCCTGTACTGTAATGCATTCTGTTCTTCAAGTAGTCCTATAGC
CTTGAGACCTCAGGGAGATATGGGCAGTTGTTCTCCCCACAGCAATATTGAACCATCGCC
TGTGGCAAGACCGCCTTCACATATGGACTTATGTAACCCACAGCCTTGCACAGTGTGCAT
GCACACACCCAAGACTGAGTCAGATAATGGAATGATGGGACTATCTCCAGATGCATATCG
GTTCCTCACAGAACAAGACAGACAGCTAAGACTACTTCAGGCACAGATTCAGCGTTTGTT
GGAAGCACAGTCTCTGATGCCCTGTTCCCCTAAGACAACTGCTGTTGAAGACACAGTGCA
AGCTGGAAGACAAATGGAGTTGGTTTCTGTGGAAGCACAGTCTTCCCCTGGCTTGCACAT
GAGAAAAGGTGTAAGCATTGCTGTGAGCACAGGTGCTAGCTTGTTTTGGAATGCAGCAGG
TGAGGATCAAGAGCCTGACTCTCAAATGAAGCAAGATGATACCAAAATTTCCAGTGAGGA
CATGAATTTTTCTGTCGATATTAATAATGAAGTCACAAGTCTTCCAGGTAGTGCATCTTC
ATTAAAAGCAGTTGATATTCCCAGTTTTGAAGAGAGCAACATTGCTGTGGAAGAAGAATT
TAACCAGCCACTTTCTGTATCCAACAGCTCTTCTCTAGTTGTGAGAAAAGAACCTGATGT
ACCTGTGTTCTTTCCAAGTGGCCAGCTGGCAGAAAGTGTAAGCATGTGTTTACAGACTGG
ACCAACAGGGGGTGCCAGTAACAATTCTGAAACATCAGAGGAACCAAAAATTGAGCATGT
AATGCAACCCTTGCTTCATCAACCATCAGATAACCAGAAAATTTACCAGGATTTATTGGG
TCAAGTAAACCACCTATTAAATAGTTCCTCCAAGGAAACTGAGCAGCCGTCTACCAAAGC
AGTAATTATCAGTCATGAATGCACCAGAACCCAAAACGTTTACCATACAAAGAAAAAAAC
ACATCATTCAAGACTGGTGGACAAAGATTGTGTCCTTAATGCAACTCTTAAGCAACTAAG
AAGCCTTGGAGTAAAAATTGATTCTCCCACTAAAGTGAAGAAAAATGCACATAACGTGGA
TCACGCCAGTGTGTTGGCATGCATCAGCCCAGAAGCAGTGATCTCTGGATTAAACTGCAT
GTCATTTGCTAATGTTGGCATGAGCGGCTTAAGCCCCAATGGTGTGGATTTGAGCATGGA
GGCAAATGCTATAGCTCTGAAATATTTAAATGAAAATCAGCTGTCACAACTGTCTGTCAC
TCGATCGAACCAAAATAATTGTGACCCATTCAGCCTTCTCCATATTAATACAGACAGAAG
CACAGTGGGGCTTAGTTTAATTTCACCAAACAACATGTCATTTGCAACCAAAAAATATAT
GAAGAGATATGGACTCCTACAAAGCAGTGACAATAGTGAAGATGAAGAGGAACCTCCCGA
CAATGCAGATAGCAAGAGTGAATATTTATTGAATCAGAACCTTAGGTCCATACCTGAACA
GCTTGGTGGTCAGAAAGAGCCTTCTAAGAATGACCATGAAATAATTAATTGTTCTAACTG
TGAATCTGTGGGGACCAACGCAGATACGCCAGTATTGAGAAATATTACAAATGAAGTTTT
GCAGACAAAAGCAAAACAGCAGTTGACTGAAAAGCCAGCTTTCTTAGTAAAGAACCTTAA
ACCAAGTCCTGCAGTGAACCTTCGAACCGGGAAAGCAGAGTTCACTCAACATCCTGAGAA
AGAAAATGAAGGGGACATTACAATTTTTCCTGAAAGTTTGCAACCTTCTGAAACGCTAAA
GCAGATGAATAGCATGAATTCAGTAGGCACCTTCTTAGATGTAAAACGTCTCAGACAGTT
ACCAAAATTATTTTAACCTTTTAACTCCCTGCCCTTTTAATACAGGGACAGGGTGTCTCC
TGAAGATACTTAGGGAAAACAGGAGCCTACCACAAGGCTCCTGATCATTCTGGAGTCACT
GTTTCTTGGTAGCAGCCAATTGGGAAGAGTGACTTCTGTGAGATGGCTGGCTGGTGATAG
GACTAAGTTCTCATTGTTCAAATAGAGCTGTTCAACATCACTGAAACCTTTAAGAAAAGC
CCTGAGATCAGTTATTCCTACAAGTTTAAGTAGTAGACAGATACTATCCAGCTCTAAGTC
TCAACTGCTCTTTTATACTGTACTTTTTTTTTTGAGACGGAGTTTTGCTCTTGTAGCCCA
GGCTGGAGTGCAATGGCAGGATCTCAGATCACTGCAACCTCTGCCTCCTGGGTTCAAGCG
ATTTTCCTGCTTCATCTTCCCAGGTAGCTGGGATTACAGGCATGTGCCACAACGCCTGGC
TAATTTTGTATTTTTAGTAGAGACTGGTTTCTCCATGTTGGTCAGGCTGGTCTCAAACTC
CCGACCTCAGGTGATCCGCCCGCCTCGGCCTCCTAAAGTGCTGGGATTACAGGCGTGAGC
CACTGCGCCCAGCTATACTGTATATTTTAAGAAGTTCCAGCATGTTGCATCTCTGCATTT
ATCCTATATCATTAAAAGAACATAAGTTATCATGGTGTTGGGTAAATTAGCGAAATCAAC
CCTTCCTAAGTTTAAGGGAAAAGTTATTTTTAAAAACAACTTAATAAAAACTTACACTCT
TTTATACAAGAGTGTATTTCCCCTTAATTAGGATGCATGTTGATTAAACTCGAGATACAG
CTTTTTGCAGTATGGTGGGTTGGTTTTGGTGTAACATCTTCAACATGTCACACTGGCTAT
CAAAGAATAAGAAAATTATTGAGTATGAGTGTGTTTTATAAACTTTCTGAGTTTTTCAGA
TGTCTTAATATTTTTTAATAGAACTTAATAAAATGTCTAGATTGACTATTTTC

Protein Sequence

>6491 : length: 1288
MEPIYPFARPQMNTRFPSSRMVPFHFPPSKCALWNPTPTGDFIYLHLSYYRNPKLVVTEK
TIRLAYRHAKQNKKNSSCFLLGSLTADEDEEGVTLTVDRFDPGREVPECLEITPTASLPG
DFLIPCKVHTQELCSREMIVHSVDDFSSALKALQCHICSKDSLDCGKLLSLRVHITSRES
LDSVEFDLHWAAVTLANNFKCTPVKPIPIIPTALARNLSSNLNISQVQGTYKYGYLTMDE
TRKLLLLLESDPKVYSLPLVGIWLSGITHIYSPQVWACCLRYIFNSSVQERVFSESGNFI
IVLYSMTHKEPEFYECFPCDGKIPDFRFQLLTSKETLHLFKNVEPPDKNPIRCELSAESQ
NAETEFFSKASKNFSIKRSSQKLSSGKMPIHDHDSGVEDEDFSPRPIPSPHPVSQKISKI
QPSVPELSLVLDGNFIESNPLPTPLEMVNNENPPLINHLEHLKPLQPQLYDEKHSPEVEA
GEPSLRGIPNQLNQDKPALLRHCKVRQPPAYKKGNPHTRNSIKPSSHNGPSHDIFEKLQT
VSAGNVQNEEYPIRPSTLNSRQSSLAPQSQPHDFVFSPHNSGRPMELQIPTPPLPSYCST
NVCRCCQHHSHIQYSPLNSWQGANTVGSIQDVQSEALQKHSLFHPSGCPALYCNAFCSSS
SPIALRPQGDMGSCSPHSNIEPSPVARPPSHMDLCNPQPCTVCMHTPKTESDNGMMGLSP
DAYRFLTEQDRQLRLLQAQIQRLLEAQSLMPCSPKTTAVEDTVQAGRQMELVSVEAQSSP
GLHMRKGVSIAVSTGASLFWNAAGEDQEPDSQMKQDDTKISSEDMNFSVDINNEVTSLPG
SASSLKAVDIPSFEESNIAVEEEFNQPLSVSNSSSLVVRKEPDVPVFFPSGQLAESVSMC
LQTGPTGGASNNSETSEEPKIEHVMQPLLHQPSDNQKIYQDLLGQVNHLLNSSSKETEQP
STKAVIISHECTRTQNVYHTKKKTHHSRLVDKDCVLNATLKQLRSLGVKIDSPTKVKKNA
HNVDHASVLACISPEAVISGLNCMSFANVGMSGLSPNGVDLSMEANAIALKYLNENQLSQ
LSVTRSNQNNCDPFSLLHINTDRSTVGLSLISPNNMSFATKKYMKRYGLLQSSDNSEDEE
EPPDNADSKSEYLLNQNLRSIPEQLGGQKEPSKNDHEIINCSNCESVGTNADTPVLRNIT
NEVLQTKAKQQLTEKPAFLVKNLKPSPAVNLRTGKAEFTQHPEKENEGDITIFPESLQPS
ETLKQMNSMNSVGTFLDVKRLRQLPKLF