ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

648

Name

BMI1

Synonym

FLVI2/BMI1|PCGF4|RNF51;BMI1 proto-oncogene, polycomb ring finger;BMI1;BMI1 proto-oncogene, polycomb ring finger

Definition

B lymphoma Mo-MLV insertion region 1 homolog|BMI1 polycomb ring finger oncogene|BMI1 polycomb ring finger proto-oncogene|flvi-2/bmi-1|murine leukemia viral (bmi-1) oncogene homolog|polycomb complex protein BMI-1|polycomb group RING finger protein 4|polyco

Position

10p11.23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

the prc2 complex sets long-term gene silencing through modification of histone tails;PID BioCarta;100063

Disease

Primary biliary cirrhosis;FunDO

Disease

Cancers;KEGG DISEASE

Disease

Cancers of the urinary system and male genital organs;KEGG DISEASE

Disease

Penile cancer;KEGG DISEASE;H00025

Disease

Cancer;FunDO

Disease

Oral cancer;FunDO

External Links

Links to cell senescence gene database

648

Links to epithelial mesenchymal transition gene database

648

Links to ovarian cancer gene database

648

Links to endometrial cancer gene database

648

Links to iHOP

648

Sequence Information

Nucleotide Sequence

>648 : length: 3435
ACAGCAACTATGAAATAATCGTAGTATGAGAGGCAGAGATCGGGGCGAGACAATGGGGAT
GTGGGCGCGGGAGCCCCGTTCCGGCTTAGCAGCACCTCCCAGCCCCGCAGAATAAAACCG
ATCGCGCCCCCTCCGCGCGCGCCCTCCCCCGAGTGCGGAGCGGGAGGAGGCGGCGGCGGC
CGAGGAGGAGGAGGAGGAGGCCCCGGAGGAGGAGGCGTTGGAGGTCGAGGCGGAGGCGGA
GGAGGAGGAGGCCGAGGCGCCGGAGGAGGCCGAGGCGCCGGAGCAGGAGGAGGCCGGCCG
GAGGCGGCATGAGACGAGCGTGGCGGCCGCGGCTGCTCGGGGCCGCGCTGGTTGCCCATT
GACAGCGGCGTCTGCAGCTCGCTTCAAGATGGCCGCTTGGCTCGCATTCATTTTCTGCTG
AACGACTTTTAACTTTCATTGTCTTTTCCGCCCGCTTCGATCGCCTCGCGCCGGCTGCTC
TTTCCGGGATTTTTTATCAAGCAGAAATGCATCGAACAACGAGAATCAAGATCACTGAGC
TAAATCCCCACCTGATGTGTGTGCTTTGTGGAGGGTACTTCATTGATGCCACAACCATAA
TAGAATGTCTACATTCCTTCTGTAAAACGTGTATTGTTCGTTACCTGGAGACCAGCAAGT
ATTGTCCTATTTGTGATGTCCAAGTTCACAAGACCAGACCACTACTGAATATAAGGTCAG
ATAAAACTCTCCAAGATATTGTATACAAATTAGTTCCAGGGCTTTTCAAAAATGAAATGA
AGAGAAGAAGGGATTTTTATGCAGCTCATCCTTCTGCTGATGCTGCCAATGGCTCTAATG
AAGATAGAGGAGAGGTTGCAGATGAAGATAAGAGAATTATAACTGATGATGAGATAATAA
GCTTATCCATTGAATTCTTTGACCAGAACAGATTGGATCGGAAAGTAAACAAAGACAAAG
AGAAATCTAAGGAGGAGGTGAATGATAAAAGATACTTACGATGCCCAGCAGCAATGACTG
TGATGCACTTAAGAAAGTTTCTCAGAAGTAAAATGGACATACCTAATACTTTCCAGATTG
ATGTCATGTATGAGGAGGAACCTTTAAAGGATTATTATACACTAATGGATATTGCCTACA
TTTATACCTGGAGAAGGAATGGTCCACTTCCATTGAAATACAGAGTTCGACCTACTTGTA
AAAGAATGAAGATCAGTCACCAGAGAGATGGACTGACAAATGCTGGAGAACTGGAAAGTG
ACTCTGGGAGTGACAAGGCCAACAGCCCAGCAGGAGGTATTCCCTCCACCTCTTCTTGTT
TGCCTAGCCCCAGTACTCCAGTGCAGTCTCCTCATCCACAGTTTCCTCACATTTCCAGTA
CTATGAATGGAACCAGCAACAGCCCCAGCGGTAACCACCAATCTTCTTTTGCCAATAGAC
CTCGAAAATCATCAGTAAATGGGTCATCAGCAACTTCTTCTGGTTGATACCTGAGACTGT
TAAGGAAAAAAATTTTAAACCCCTGATTTATATAGATATCTTCATGCCATTACAGCTTTC
TAGATGCTAATACATGTGACTATCGTCCAATTTGCTTTCTTTTGTAGTGACATTAAATTT
GGCTATAAAAGATGGACTACATGTGATACTCCTATGGACGTTAATTGAAAAGAAAGATTG
TTGTTATAAAGAATTGGTTTCTTGGAAAGCAGGCAAGACTTTTTCTCTGTGTTAGGAAAG
ATGGGAAATGGTTTCTGTAACCATTGTTTGGATTTGGAAGTACTCTGCAGTGGACATAAG
CATTGGGCCATAGTTTGTTAATCTCAACTAACGCCTACATTACATTCTCCTTGATCGTTC
TTGTTATTACGCTGTTTTGTGAACCTGTAGAAAACAAGTGCTTTTTATCTTGAAATTCAA
CCAACGGAAAGAATATGCATAGAATAATGCATTCTATGTAGCCATGTCACTGTGAATAAC
GATTTCTTGCATATTTAGCCATTTTGATTCCTGTTTGATTTATACTTCTCTGTTGCTACG
CAAAACCGATCAAAGAAAAGTGAACTTCAGTTTTACAATCTGTATGCCTAAAAGCGGGTA
CTACCGTTTATTTTACTGACTTGTTTAAATGATTCGCTTTTGTAAGAATCAGATGGCATT
ATGCTTGTTGTACAATGCCATATTGGTATATGACATAACAGGAAACAGTATTGTATGATA
TATTTATAAATGCTATAAAGAAATATTGTGTTTCATGCATTCAGAAATGATTGTTAAAAT
TCTCCCAACTGGTTCGACCTTTGCAGATACCCATAACCTATGTTGAGCCTTGCTTACCAG
CAAAGAATATTTTTAATGTGGATATCTAATTCTAAAGTCTGTTCCATTAGAAGCAATTGG
CACATCTTTCTATACTTTATATACTTTTCTCCAGTAATACATGTTTACTTTAAAGATTGT
TGCAGTGAAGAAAAACCTTTAACTGAGAAATATGGAAACCGTCTTAATTTTCCATTGGCT
ATGATGGAATTAATATTGTATTTTAAAAATGCATATTGATCACTATAATTCTAAAACAAT
TTTTTAAATAAACCAGCAGGTTGCTAAAAGAAGGCATTTTATCTAAAGTTATTTTAATAG
GTGGTATAGCAGTAATTTTAAATTTAAGAGTTGCTTTTACAGTTAACAATGGAATATGCC
TTCTCTGCTATGTCTGAAAATAGAAGCTATTTATTATGAGCTTCTACAGGTATTTTTAAA
TAGAGCAAGCATGTTGAATTTAAAATATGAATAACCCCACCCAACAATTTTCAGTTTATT
TTTTGCTTTGGTCGAACTTGGTGTGTGTTCATCACCCATCAGTTATTTGTGAGGGTGTTT
ATTCTATATGAATATTGTTTCATGTTTGTATGGGAAAATTGTAGCTAAACATTTCATTGT
CCCCAGTCTGCAAAAGAAGCACAATTCTATTGCTTTGTCTTGCTTATAGTCATTAAATCA
TTACTTTTACATATATTGCTGTTACTTCTGCTTTCTTTAAAAATATAGTAAAGGATGTTT
TATGAAGTCACAAGATACATATATTTTTATTTTGACCTAAATTTGTACAGTCCCATTGTA
AGTGTTGTTTCTAATTATAGATGTAAAATGAAATTTCATTTGTAATTGGAAAAAATCCAA
TAAAAAGGATATTCATTTAGAAAATAGCTAAGATCTTTAATAAAAATTTGATATGAAAAG
CACAATGTGCAGAAGTTATGGAAAACCTATAGAGGATTACAACAGGTAAACGTTAAAGAG
AATACATTGCTGACTTATAGTGATGTGGCTAAGAAGTACATGCTTTGTTGTAAAATTGCT
TGAAAGCCCATTGAAAGATGTATCTGTTTATTTACAGTCTTTGAAGTAAAAGTTACCAAT
GTTTGCCAATAAAAA

Protein Sequence

>648 : length: 326
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQV
HKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE
DKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLR
SKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQR
DGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSP
SGNHQSSFANRPRKSSVNGSSATSSG