ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

64783

Name

RBM15

Synonym

OTT|OTT1|SPEN;RNA binding motif protein 15;RBM15;RNA binding motif protein 15

Definition

RNA-binding motif protein 15|one twenty two protein|one twenty-two|one-twenty two protein 1|putative RNA-binding protein 15

Position

1p13

Gene Type

protein-coding

External Links

Links to cell senescence gene database

64783

Links to epithelial mesenchymal transition gene database

64783

Links to ovarian cancer gene database

64783

Links to endometrial cancer gene database

64783

Links to iHOP

64783

Sequence Information

Nucleotide Sequence

>64783 : length: 7316
GGCGTCAGCATGACCCGAGGCTGCAGGAACCGTGAACTCTCTGCCCCGCGGGCCCAGGTG
ACCGCGGGCGGCGCTCTCCCGCGCGCGGGGGGCGGGGCTCCCCCCGGCTGTTCACTCAGC
TACCACAGCGACGTAAAATGGTGTCCGCTAGGCGTCCCAGGACGGCTTCCTGAGGGACTG
GAGGGCCCCGACAGCCGGAAAGCCTGCCCCGCCCCTTGGCCGGCACAGGTACGACGGCGG
GGAGCTCAGAAGTTTCGAACTCCAAGGGCCGAAGCACAGCCAAACACCCCACGGAACTTA
ACAAATGTTTGTGGGGAGAACGCCGAAAACGCGGGGAGGCGGGGCTGGCGCACAGTCACC
CTCTCGCGACATCTAAGTGACGTCGCACAGCAAGCACGTGTTCTAGTCTTTCACCTTCAG
TCAGCCTCCTCCGTTATACAGGCCTACCCCTTTAAGCGAGTGATGGACAGTTATTTCAGC
CTATCAACTTCCTTGCCGACATCCAATCAGATTTAAACTTCTTTTAGCCGCCGGAGGAGT
TGGAAAAAGGGGGTCGAAAGAGGGAGCTTACCGTCTCTCGCGATATCGCTGTGAGCCTGC
CTCTCTGGAAAAAACGCCGAAACTGATGGCCCGACCTCCCAAATAGTGGTTTAAAGGACG
GGTTTATAAGCCAATGAAAGGGATAAGGAGGTGGGTTGCTGCTGTCACTGAGCAAGAAGT
ACCGTTACAGGGCAGACTTTTTGTCCAATCAACACCTCAACACTTTGGGTCACGTGACCG
CAGAGTGCGAGGGGCGGAGCTACAGTCTGGCGCGAGGAACCGTTAAGATAGACAACAAAT
GTAACCAATGAGGTACTCCGACTAGGGGGTTGGGAACCCAATAACAGTGGTTGGGCGGGC
GCCTTCCTGGAGCGCGGGGAGATGTAAAGATAGACAAATAATTTTCCCAATGAGACTGTA
GAAGAGAGAGCAATTGGCCAATGAGGACTGCGGGGCGGGACCCTGTGCCGCGGCGGAGTC
CAAGATGGCGGCGTGCGGTTCCGCTGTGTGAAACGAGCGCGGGGCGGCGGGTTACTCAGC
TCCGCGGAGACGACCTCCGACGACCCGCAACAATGAAGGGAAAAGAGCGCTCGCCAGTGA
AGGCCAAACGCTCCCGTGGTGGTGAGGACTCGACTTCCCGCGGTGAGCGGAGCAAGAAGT
TAGGGGGCTCTGGTGGCAGCAATGGGAGCAGCAGCGGAAAGACCGATAGCGGCGGTGGGT
CGCGGCGGAGTCTCCACCTGGACAAGTCCAGCAGTCGAGGTGGCAGCCGCGAGTATGATA
CCGGTGGGGGCAGCTCCAGTAGCCGCTTGCATAGTTATAGCTCCCCGAGCACCAAAAATT
CTTCGGGCGGGGGCGAATCGCGCAGCAGCTCCCGGGGTGGAGGCGGGGAGTCACGTTCCT
CTGGGGCCGCCTCCTCAGCTCCCGGCGGCGGGGACGGCGCGGAATACAAGACTCTGAAGA
TAAGCGAGTTGGGGTCCCAGCTTAGTGACGAAGCGGTGGAGGACGGCCTGTTTCATGAGT
TCAAACGCTTCGGTGATGTAAGTGTGAAAATCAGTCATCTGTCGGGTTCTGGCAGCGGGG
ATGAGCGGGTAGCCTTTGTGAACTTCCGGCGGCCAGAGGACGCGCGGGCGGCCAAGCATG
CCAGAGGCCGCCTGGTGCTCTATGACCGGCCTCTGAAGATAGAAGCTGTGTATGTGAGCC
GGCGCCGCAGCCGCTCCCCTTTAGACAAAGATACTTATCCTCCATCAGCCAGTGTGGTCG
GGGCCTCTGTAGGTGGTCACCGGCACCCCCCTGGAGGTGGTGGAGGCCAGAGATCACTTT
CCCCTGGTGGCGCTGCTTTGGGATACAGAGACTACCGGCTGCAGCAGTTGGCTCTTGGCC
GCCTGCCCCCTCCACCTCCGCCACCATTGCCTCGAGACCTGGAGAGAGAAAGAGACTACC
CGTTCTATGAGAGAGTGCGCCCTGCATACAGTCTTGAGCCAAGGGTGGGAGCTGGAGCAG
GTGCTGCTCCTTTCAGAGAAGTGGATGAGATTTCACCCGAGGATGATCAGCGAGCTAACC
GGACGCTCTTCTTGGGCAACCTAGACATCACTGTAACGGAGAGTGATTTAAGAAGGGCGT
TTGATCGCTTTGGAGTCATCACAGAAGTAGATATCAAGAGGCCTTCTCGCGGCCAGACTA
GTACTTACGGCTTTCTCAAATTTGAGAACTTAGATATGTCTCACCGGGCCAAATTAGCAA
TGTCTGGCAAAATTATAATTCGGAATCCTATCAAAATTGGTTATGGTAAAGCTACACCCA
CCACCCGCCTCTGGGTGGGAGGCCTGGGACCTTGGGTTCCTCTTGCTGCCCTGGCACGAG
AATTTGATCGATTTGGCACCATACGCACCATAGACTACCGAAAAGGTGATAGTTGGGCAT
ATATCCAGTATGAAAGCCTGGATGCAGCGCATGCTGCCTGGACCCATATGCGGGGCTTCC
CACTTGGTGGCCCAGATCGACGCCTTAGAGTAGACTTTGCCGACACCGAACATCGTTACC
AGCAGCAGTATCTGCAGCCTCTGCCCTTGACTCATTATGAGCTGGTGACAGATGCTTTTG
GACATCGGGCACCAGACCCTTTGAGGGGTGCTCGGGATAGGACACCACCCTTACTATACA
GAGATCGTGATAGGGACCTTTATCCTGACTCTGATTGGGTGCCACCCCCACCCCCAGTCC
GAGAACGCAGCACTCGGACTGCAGCTACTTCTGTGCCTGCTTACGAGCCACTGGATAGCC
TAGATCGCAGGCGGGATGGTTGGTCCTTGGACCGGGACAGAGGTGATCGAGATCTGCCCA
GCAGCAGAGACCAGCCTAGGAAGCGAAGGCTGCCTGAGGAGAGTGGAGGACGTCATCTGG
ATAGGTCTCCTGAGAGTGACCGCCCACGAAAACGTCACTGCGCTCCTTCTCCTGACCGCA
GTCCAGAATTGAGCAGTAGCCGGGATCGTTACAACAGCGACAATGATCGATCTTCCCGTC
TTCTCTTGGAAAGGCCCTCTCCAATCAGAGACAGACGAGGTAGTTTGGAGAAGAGCCAGG
GTGACAAGCGAGACCGTAAAAACTCTGCATCAGCTGAACGAGATAGGAAGCACCGGACAA
CTGCTCCCACTGAGGGAAAAAGCCCTCTGAAAAAAGAAGACCGCTCTGATGGGAGTGCAC
CTAGCACCAGCACTGCTTCCTCCAAGCTGAAGTCCCCGTCCCAGAAACAGGATGGGGGGA
CAGCCCCTGTGGCATCAGCCTCTCCCAAACTCTGTTTGGCCTGGCAGGGCATGCTTCTAC
TGAAGAACAGCAACTTTCCTTCCAACATGCATCTGTTGCAGGGTGACCTCCAAGTGGCTA
GTAGTCTTCTTGTGGAGGGTTCAACTGGAGGCAAAGTGGCCCAGCTCAAGATCACTCAGC
GTCTCCGTTTGGACCAGCCCAAGTTGGATGAAGTAACTCGACGCATCAAAGTAGCAGGGC
CCAATGGTTATGCCATTCTTTTGGCTGTGCCTGGAAGTTCTGACAGCCGGTCCTCCTCTT
CCTCAGCTGCATCAGACACTGCCACTTCTACTCAGAGGCCACTTAGGAACCTTGTGTCCT
ATTTAAAGCAAAAGCAGGCAGCCGGGGTGATCAGCCTCCCTGTGGGGGGCAACAAAGACA
AGGAAAACACCGGGGTCCTTCATGCCTTCCCACCTTGTGAGTTCTCCCAGCAGTTCCTGG
ATTCCCCTGCCAAGGCACTGGCCAAATCTGAAGAAGATTACCTGGTCATGATCATTGTCC
GTGGGTTTGGTTTTCAGATAGGAGTTAGGTATGAGAACAAGAAGAGAGAAAACTTGGCGC
TGACCCTGTTATAGTGGTTATAGTGGTGTCCCTAAAGGGAGGAAATGATTTCAGGTAACC
ACAGTGAAATGTTAAGCTGAATGAAGAGTTTTATATGTATGGTTTAAACAGAGTTGAAAA
GTGAGATTCCTGAAGTGTTCTTTGGCTGTTTAACAATTATTTGTATGAGTGTTTTATTAA
AATAACGGCTGCTGTCTTTGGTAACATAGATGAGGGTGGATTTTTAAATGGCTTTGTATC
GACCCCTTTCTACAATAATGGAGTAGTCTATGTTGCTCCATATAAATTACAGAATGAAAA
TAGATGGGGCAAAAGTTTGACTAAACTTTACCTTTTTATAGTTTCACTTTTTAAGTTATA
TTTAGAATATATTGATAGATTATAAATTGATTGTGAAACTTTTTTCTGAATTTTTTCAAC
ATGTTTTACTCAGTTACATGAGTTAAAGGATATTTTCAGTCCTGTTATCTTCAATTGCAG
TCTTTAAAAAAACCCACCCTATTGTTCTACTTGTTATATGTCTATTCATACAGTAAATTC
ATTTCAAGGTTTATGCCAGTGGGTATTATTGGTGCTTTTTGAAGTTGAGGTGAACCATCC
AGGAAGGTCTTGTTAATGTTATGTTCATCTATAATGGCATAGGGGAAATATATATATTTT
TAATATTGTAAACATTTGTACTGAATAACCTTTTTTTCCCCCCCTCCGCAAGCAAAACTG
GTTGAACAGCGGATGAAGATATGGAATTCAAAGCTCTAATGGACCTTTTTGAAGAGAAGT
TGTGGCTTATGTGGAGTTTACATGGGCCTCTGATGGAAGAAAGCTAATCTGTTTAGTATT
TGTGCATTTTACTAAAATGGCAGCTTAAAGTTGTGTATCTGCTATTGTGATGCCAATGCC
GGTGTTTTAAGTGGAAAAAAAATGACCTCTTTGATTTGTGCTGTGTACACAAGATTTCTG
GAAAAGTAAAGAAAAACCCTTTTTATGGCTCACACAGCTTAAGAGTAGCTGTCTCTCAAA
CGTGCGCTCACAGTTGAGCTGCTTTTGTTTTATTCTAAATAAATTGTTTCTTTTGAGGAA
AATGTTTTTCTGCCTGGAAGTGAATTGACGGCAAACCTTTGACCCCTTTGTTTGCAGCCG
AGGGGGTGCTTGCTGCTGCTCAGATCTTGTATGTCTTGAGCAAGAAGCAGGGAGACCATC
AATTTCATTTTGACTATCACGGTGTGTCAATTCTGAAGGATCACTAGTGTTACTGTTGAC
CCCCTTTGTTTGCAGTGAAGGGGATCATTTGCTTCTCGGTTCTCAACGTGATGAGGAAAT
GGTGCTGTTTGCTGGCACGCAAGAAGCCGGGGCAGGCACCCTAAGCCTCACCACAGTGCC
TGAGTCGGGGGCTTTTGCTGGTTTGAAGAGCTGGAGTTGCTGAAATTTAAGTTTTGATTT
ATTTTGTTCACCCATCACGTTTGGCCTTAGTTTCATTTTTAATTTGAAGAAAAGTTTGAA
ATTGCTTTATCTTGCACTTAACATTTGCACCAAATTGCCAAAAGAAGGAGAAATGCTCCG
TTTGCTTTTTAAATGTTAATGATGATGTTAATAAAGCCTTTCCTGACACATTTGAGGAGC
TCCTCCGTCTCCAGGGGCTTCTTACCAGAGTTATGCAGTGATGGGTTTAGTTCTGAATGG
ATGAAGAGTTCCTGAGAGCTAGCGTTTGTAATTAGAACCGTTACTTGGTATCTGTGCCTT
ATTTGACCTTTGGTTCCACATGCCTTGGATGTGCATGCACCGTGACGGTTTCATAGGTAC
GAACGCACACTCAGGCCCAGTCACTTCGGTTGGTAGTACAGATTGTGAGGAAAAAGATGG
AGGCATCCTTAAGGAGGAAAAATGTTTGCCTTTAGTTCCTGCATTATCCTGTACAGAGGG
GCTCCTGAGTTTTGGAAGCCTGTTCCCAGTACAGGAGAACAACTCCCCTGTTTGCAGCAG
GAGACTTCAGTGCACGGTGACAACGCTGGAGTTCAAGAGGAAGCCAGCAATGCTGCACCA
TTGGCTTCAGACACCATTGTTGTTGTTTGCCAGTTTTAAACTTAACTAGTTGCAGACGAA
GACCACCTTGAAATGCAGGCTTGTTGGGCTTGTTTTGAATTTTAACCTCGGATGGAAGAG
CCCTAGTGCTGTCTGTCTCCATGCGGGATGATGATTGCTAGGCAACAGGTGATTATCAAC
AAAGGATGCCACGGTTATACTCTGCAAGGTGGTGTTCCAGTGGCAAACAGCTGTATAAAC
TCTTGTAAACAGTCCTGAAGATGGGCCACTGTTTTGTTTATGAAATGCTAAAGGGACACC
AGAAAAGTTTTGTGACTAACTGAAGGATACACAGCCAGGAACTGATTGAGGAACTACTGA
CAAAAACCTATAGTCGACTTTGGGATCTGACTTTATTATTCAGCAACTCAAAGATGAGTT
CTAATTGGCAGACTTCTGGCACTGGCACTTGTCCTCCTGTTTCTATAGAAACTGGGTTGG
AAGTCAGAGCTGCACAAAGGGAAAGGGAAGGAGAGAAATATTGTTCATGTAATGTGTTAC
CTTTTTTTGTCTGTGTGATCTACAAGAGCATGGCTGAAATGTTACCATTTTTAACTAGTG
TTTTGACTGAAGATTATTATGAAAAGTTTTACTTTTGTTAGATTCCTAATTAAAAATGCC
TATACTCTTTTATAGGAGTTTCAACTTTTGCAATTTGGTAATAACAGATTTAGGTAAGTA
AAAAATGAGAATCTCATACAGTTCTGAAGATCTAAGTTTGGTTGAGAATTTAATGTTTCA
TCACCAGTAAATTCAATTAAAGACTTTTGATTCAATTAAAGACTCAGTTCTGCCTACACC
TGCAAGAACTGAGTTGATCTGTACATCAACATTTCTGATGTTTCTTTGGTAGTTGCTGCT
GGAGTCAGAAGTTAGGAACAAATCTAATGGCCTTTGTAATGTCCTCTGTCATTTCACGGA
GGAATGACTTAGAGGAACAAAGCTTTCCTGTGATTTCTTTCTTCAACAGATGGCTAATGG
CACAGCATTGCAGTTAGAATCTTGTTTAAGATACTAGGAGCACGTCCTGGACTAAAAATT
TCTACATAAGCTTTAGCAACAACCTTATAGCTTCCTTTGACTTTTTTGTAGAGCTTACAG
AATGTATGGCTGCCTAAGTAATAGTCTCTGAATTAATGGGTAAAAAATATATTATGAGTT
TTTTATCCTCACGTATGGTGCTAGGCTATACTGGATTTGGGCTAACAAAAGCTTGTTAAC
TTTTTTTTGTCTCATTGACAGAAGTATTTTATATCTCATATTTTACATTACATAGGTGTG
TGTGTGTGTATGAAATAAAAGTTTGAAAATAAAGTGATATACTCTTTTTTAATCTG

Protein Sequence

>64783 : length: 977
MRTAGRDPVPRRSPRWRRAVPLCETSAGRRVTQLRGDDLRRPATMKGKERSPVKAKRSRG
GEDSTSRGERSKKLGGSGGSNGSSSGKTDSGGGSRRSLHLDKSSSRGGSREYDTGGGSSS
SRLHSYSSPSTKNSSGGGESRSSSRGGGGESRSSGAASSAPGGGDGAEYKTLKISELGSQ
LSDEAVEDGLFHEFKRFGDVSVKISHLSGSGSGDERVAFVNFRRPEDARAAKHARGRLVL
YDRPLKIEAVYVSRRRSRSPLDKDTYPPSASVVGASVGGHRHPPGGGGGQRSLSPGGAAL
GYRDYRLQQLALGRLPPPPPPPLPRDLERERDYPFYERVRPAYSLEPRVGAGAGAAPFRE
VDEISPEDDQRANRTLFLGNLDITVTESDLRRAFDRFGVITEVDIKRPSRGQTSTYGFLK
FENLDMSHRAKLAMSGKIIIRNPIKIGYGKATPTTRLWVGGLGPWVPLAALAREFDRFGT
IRTIDYRKGDSWAYIQYESLDAAHAAWTHMRGFPLGGPDRRLRVDFADTEHRYQQQYLQP
LPLTHYELVTDAFGHRAPDPLRGARDRTPPLLYRDRDRDLYPDSDWVPPPPPVRERSTRT
AATSVPAYEPLDSLDRRRDGWSLDRDRGDRDLPSSRDQPRKRRLPEESGGRHLDRSPESD
RPRKRHCAPSPDRSPELSSSRDRYNSDNDRSSRLLLERPSPIRDRRGSLEKSQGDKRDRK
NSASAERDRKHRTTAPTEGKSPLKKEDRSDGSAPSTSTASSKLKSPSQKQDGGTAPVASA
SPKLCLAWQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGSTGGKVAQLKITQRLRLDQP
KLDEVTRRIKVAGPNGYAILLAVPGSSDSRSSSSSAASDTATSTQRPLRNLVSYLKQKQA
AGVISLPVGGNKDKENTGVLHAFPPCEFSQQFLDSPAKALAKSEEDYLVMIIVRGFGFQI
GVRYENKKRENLALTLL