ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

64778

Name

FNDC3B

Synonym

FAD104|PRO4979|YVTM2421;fibronectin type III domain containing 3B;FNDC3B;fibronectin type III domain containing 3B

Definition

HCV NS5A-binding protein 37|factor for adipocyte differentiation 104|fibronectin type III domain-containing protein 3B

Position

3q26.31

Gene Type

protein-coding

External Links

Links to cell senescence gene database

64778

Links to epithelial mesenchymal transition gene database

64778

Links to ovarian cancer gene database

64778

Links to endometrial cancer gene database

64778

Links to iHOP

64778

Sequence Information

Nucleotide Sequence

>64778 : length: 7027
GCGGCGGCGGCGGCTGGAGGAGGAGAGCGGCGGCGGCGGGAGCAGCGAAGGGGGCGGCAG
GGATCCTCCAGGCTGCCGGCTGGGAAGGCGTGGGCGACCCGGTGTGTGGCGCGCCCAGAG
CCCCGCGTTTCAGCCCTAGGGAAGGAAGCCAGTTGAGGGAAGTTCTCCATGAATGTACGT
CACAATGATGATGACCGACCAAATCCCTCTGGAACTGCCACCATTGCTGAACGGAGAGGT
AGCCATGATGCCCCACTTGGTGAATGGAGATGCAGCTCAGCAGGTTATTCTCGTTCAAGT
TAATCCAGGTGAGACTTTCACAATAAGAGCAGAGGATGGAACACTTCAGTGCATTCAAGG
ACCTGCTGAAGTTCCCATGATGTCACCCAATGGATCCATTCCTCCCATTCATGTGCCTCC
AGGTTATATCTCACAGGTGATTGAAGATAGTACTGGAGTCCGCCGGGTGGTGGTCACACC
CCAGTCTCCTGAGTGTTATCCCCCAAGCTACCCCTCAGCCATGTCTCCAACCCATCATCT
CCCTCCCTATCTGACTCACCATCCACATTTTATTCATAACTCACACACGGCTTACTACCC
ACCTGTTACCGGACCTGGAGATATGCCGCCTCAGTTTTTTCCCCAGCATCATCTTCCCCA
CACAATATATGGTGAGCAAGAAATTATACCATTTTATGGAATGTCAACCTACATCACCCG
AGAAGACCAGTACAGCAAGCCTCCGCACAAAAAACTGAAAGACCGCCAGATCGATCGCCA
GAACCGCCTCAACAGCCCTCCTTCTTCTATCTACAAAAGCAGCTGCACAACAGTATACAA
TGGCTATGGGAAGGGCCATAGTGGTGGAAGTGGCGGAGGCGGCAGCGGTAGTGGTCCCGG
AATTAAGAAAACAGAGCGACGAGCAAGAAGCAGCCCAAAGTCGAATGATTCAGACTTGCA
AGAATATGAGTTGGAAGTAAAGAGGGTGCAAGACATTCTTTCGGGAATAGAGAAACCACA
GGTTTCTAATATTCAGGCAAGAGCAGTTGTGTTGTCCTGGGCTCCCCCTGTTGGACTTTC
CTGTGGACCCCACAGTGGTCTTTCCTTCCCCTACAGTTACGAGGTGGCCTTATCAGACAA
AGGACGAGATGGAAAATACAAGATAATTTACAGTGGAGAAGAATTAGAATGTAACCTGAA
AGATCTTAGACCAGCAACAGATTATCATGTGAGGGTGTATGCCATGTACAATTCCGTAAA
GGGATCCTGCTCCGAGCCTGTTAGCTTCACCACCCACAGCTGTGCACCCGAGTGTCCTTT
CCCCCCTAAGCTGGCACATAGGAGCAAAAGTTCACTAACCCTGCAGTGGAAGGCACCAAT
TGACAACGGTTCAAAAATCACCAACTACCTTTTAGAGTGGGATGAGGGAAAAAGAAATAG
TGGTTTCAGACAGTGCTTCTTCGGGAGCCAGAAGCACTGCAAGTTGACAAAGCTTTGTCC
GGCAATGGGGTACACATTCAGGCTGGCCGCTCGAAACGACATTGGTACCAGTGGTTATAG
CCAAGAGGTGGTGTGCTACACATTAGGAAATATCCCTCAGATGCCTTCTGCACCAAGGCT
GGTTCGAGCTGGCATCACATGGGTCACGTTGCAGTGGAGTAAGCCAGAAGGCTGTTCACC
CGAGGAAGTGATCACCTACACCTTGGAAATTCAGGAGGATGAAAATGATAACCTTTTCCA
CCCAAAATACACTGGAGAGGATTTAACCTGTACTGTGAAAAATCTCAAAAGAAGCACACA
GTATAAATTCAGGCTGACTGCTTCTAATACGGAAGGAAAAAGCTGTCCAAGCGAAGTTCT
TGTTTGTACGACGAGTCCTGACAGGCCTGGACCTCCTACCAGACCGCTTGTCAAAGGCCC
AGTTACATCTCATGGCTTTAGTGTCAAATGGGATCCCCCTAAGGACAATGGTGGTTCAGA
AATCCTCAAGTACTTGCTAGAGATTACTGATGGAAATTCTGAAGCGAATCAGTGGGAAGT
GGCCTACAGTGGGTCGGCTACCGAATACACCTTCACCCACTTGAAACCAGGCACTTTGTA
CAAACTCCGAGCATGCTGCATCAGTACCGGCGGACACAGCCAGTGTTCTGAAAGTCTCCC
TGTTCGCACACTAAGCATTGCACCAGGTCAATGTCGACCACCGAGGGTTTTGGGTAGACC
AAAGCACAAAGAAGTCCACTTAGAGTGGGATGTTCCTGCATCGGAAAGTGGCTGTGAGGT
CTCAGAGTACAGCGTGGAGATGACGGAGCCCGAAGACGTAGCCTCGGAAGTGTACCATGG
CCCAGAGCTGGAGTGCACCGTCGGCAACCTGCTTCCTGGAACCGTGTATCGCTTCCGGGT
GAGGGCTCTGAATGATGGAGGGTATGGTCCCTATTCTGATGTCTCAGAAATTACCACTGC
TGCAGGGCCTCCTGGACAATGCAAAGCACCTTGTATTTCTTGTACACCTGATGGATGTGT
CTTAGTGGGTTGGGAGAGTCCTGATAGTTCTGGTGCTGACATCTCAGAGTACAGGTTGGA
ATGGGGAGAAGATGAAGAATCCTTAGAACTCATTTATCATGGGACAGACACCCGTTTTGA
AATAAGAGACCTGTTGCCTGCTGCACAGTATTGCTGTAGACTACAGGCCTTCAATCAAGC
AGGGGCAGGGCCGTACAGTGAACTTGTCCTTTGCCAGACGCCAGCGTCTGCCCCTGACCC
CGTCTCCACTCTCTGTGTCCTGGAGGAGGAGCCCCTTGATGCCTACCCTGATTCACCTTC
TGCGTGCCTTGTACTGAACTGGGAAGAGCCGTGCAATAACGGATCTGAAATCCTTGCTTA
CACCATTGATCTAGGAGACACTAGCATTACCGTGGGCAACACCACCATGCATGTTATGAA
AGATCTCCTTCCAGAAACCACCTACCGGATCAGAATTCAGGCTATAAATGAAATTGGAGC
TGGACCATTTAGTCAGTTCATTAAAGCAAAAACTCGGCCATTACCACCCTTGCCTCCTAG
GCTAGAATGTGCTGCTGCTGGTCCTCAGAGCCTGAAGCTAAAATGGGGAGACAGTAACTC
CAAGACACATGCTGCTGAGGACATTGTGTACACACTACAGCTGGAGGACAGAAACAAGAG
GTTTATTTCAATCTACAGAGGACCCAGCCACACCTACAAGGTCCAGAGACTGACGGAATT
CACATGCTACTCCTTCAGAATCCAGGCAGCAAGCGAGGCTGGAGAAGGGCCCTTCTCAGA
AACCTATACCTTCAGCACAACCAAAAGTGTCCCCCCCACCATCAAAGCACCTCGAGTAAC
ACAGTTAGAAGGAAATTCATGTGAAATTTTATGGGAGACGGTACCATCAATGAAAGGTGA
CCCTGTTAACTACATTCTGCAGGTATTGGTTGGAAGAGAATCTGAGTACAAACAGGTGTA
CAAGGGAGAAGAAGCCACATTCCAAATCTCAGGCCTCCAGACCAACACAGACTACAGGTT
CCGCGTATGTGCGTGTCGTCGCTGTTTAGACACCTCTCAGGAGCTAAGCGGAGCCTTCAG
CCCCTCTGCGGCTTTTGTATTACAACGAAGTGAGGTCATGCTTACAGGGGACATGGGGAG
CTTAGATGATCCCAAAATGAAGAGCATGATGCCTACTGATGAACAGTTTGCAGCCATCAT
TGTGCTTGGCTTTGCAACTTTGTCCATTTTATTTGCCTTTATATTACAGTACTTCTTAAT
GAAGTAAACCCAACAAAACTAGAGGTATGAATTAATGCTACACATTTTAATACACACATT
TATTCAGATACTCCCCTTTTTAAAGCCCTTTTGTTTTTTGATTTATATACTCTGTTTTAC
AGATTTAGCTAGAAAAAAAATGTCAGTGTTTTGGTGCACCTTTTTGAAATGCAAAACTAG
GAAAAGGTTAAACTGGATTTTTTTTTTTAAAAAAAAGAAAAAAAAAGAAGAAAAGTATAC
CAGATACCAAAAGCTAGCTTTCTTATGTTTTCCTTTAAATTTTCAGATTTACCTTCATTC
TGTTTTCACTGATGTCTTTTGCAAGCCTTTGATTTTTTTTTTTTTGTTACAGTTTAGTAA
TTTATATTCACCAGTCACTTCATATGTCTTGAACATCTGTATCTGTAAACATGAATCACC
GTGTGTGTACTTACAGGGCTAGGATTTCAGTGTTGTCAGAGTATTACCACACAGCAACAG
CAACATACAGAAGATATGTTCACTCAGATAAGACTGCCCTAAACAACCATTTTGTCACTC
AGTTATTTAACTGTGTTTAGCTCATTTAAATCAAAATGTGTACTTTAATCTAAAATGTTT
TAATAATCTGTATTTCTTATAATTTTAACACTATGAGCTGCCTGTATAAGAAATCAAGTA
ACCAGAATGCACCTATAAATTATGGAGCATTGTAGATTTTACCACATCAATTCATAGCAG
TAACTTTAAGAGGGCATTGTGCAATAGTTAGTTGTTTTCTTGTTCAGCTATTTTAAAGGC
TGCTTTAACTTGTTTGTTTGTCTTTGTATATAACTACTTCTAATCTAATCACTAGAGTTA
TTATATTCTGTTATGTTTGACCAGAATTATATGACAAGAACTGGTGACAGTTTAGTGCCT
CTGCCCATTGTCCATGATTTACACTAATTGTGAGCAGTCTTCTTATGTGTCAGCTCATTA
TTTTTGAAACATTTGCCTTTAGGCTGTTCTTTGAGGTATCAATGAAGTGATTGAATTTCA
ATACCTTAATTCAGTGCACATAATACTAATGTAACAGCAGATGAAAATTGATAAAACCCA
AAAGAGAGTCATCTAAATTTGTAGTTCCTATTTCTGTGGGTTTGCCTGGCCATGGTTGGA
GAGGGAATGGTGTTTGATGGTAAACACAGGGTGTTTGGGGATCAAGGAGCCTAGATTCTC
TCCCTGGATCTGTCACTAACTTGCTGCGTGACCTGAACACGTCACTTTACCTCTCTGTGC
CTCAGTTTTCCCATGCATGAAAAATAAAATAAAATAAAACGGGGATTCTAATGTTTGTAA
GTGCTTTGAGATCTTTGACCAACAGGTGCTATTGGAGTGCAAAGTGTTACTCTTACGTGT
TTATTTTGAGTCATGAGATAATCAATTTTAACCCAAAGTCATTGGATTATTTATATGAAG
TCCATAATGTTCGAGTACCTCAGGGACATTTAAGAGTTGGAGGTGCAAATATATTCCAAA
AGGGTGCAACAGACACAGTGTATCCCCCTGCTTCTGTTTTTGTATATTTTTGCTACTTGG
TTTTTCTTGATCATAGCTATTTTGTGCTTGATCTTTATTGTCTAAGATGCAGTATCCTGT
ACTAGCTTATAATATTCCCATACCAAAGTCATGGGGAAACAAACATTATTTTGTTTTTGG
TTTATTTATACTATATTCTGCATACAGTACTTTAAATGCCAATTACAGTGCAATCTTTAT
TTATTGTAAAATTTTTTAAGTGTACTTATGTACTAATTTTCCCTTGTAGCATGTTATATT
TTTGTGTTTTATACTTTTGTAATTTTAGGTCAGTCTTGTTCCTTGGCAACATCTGTAGTA
TTATTAATCTTCTGACATTTTCTTATGTTTTTAAAAAGATAAGAGCATCTAGTGCATTAA
ATGCCAAAAAAAAAATACATTATCAGTGATTGAAACGTTTACATGTACCCAAAAACCATA
ATCATCTCTTGGAAGAAAATGCTGAGATCAATGAATTATTCTGTGTGCCTATATTGACGT
AGTGAGTACTAGAGAGTTCTGTATTTTATTATTGACTATAATAATTAGTTTAATTAGCTT
TGCAAACTGATGGCATCAAGGTAAATATATTTTTGCCAAAGTTCTGGCCTTCCAAAACTC
ACCCCCTTATTTAAATGTGTGCTATGACCCACTATGACCACAGCATCTGCATTTTCTAAA
AAATTCCATGCAGGTGTTTTGGGGAGAGGTATTTTTTAAGCAATGAAAATTCAACTGAGT
ACAAAGCCCCCTCTTGGGGGGTTGGGGAAGTCTCTTTTTTGAAACACTTCAGAACTGCTG
CTATAAAGAAATTCTCTAATTGGTTGAATTTTTTTTTTAAGTAAATAGTACTTTAGGCCA
AAATTTATATGAATATTTGATCTTCTTGAGATTTTCATACTATCATTTAACCACCAGGAA
GCTGAAGTGTGTGAAGTACAAAGCTGACAGCACTTTATTTTATTGCTCTCCATTATTTGG
TATTCATTATATTCCTTCAGTCAGAAAATTATTACTCTCTATGGCACTGTTTTTTATCAC
AAATATGTATATGTGATATTGATATATAACTATATATATTGCCATCACACACGAACAATA
AAATAAAGTGTTCTATTAACCTGATCTCTTTGCCCTTTTGCTATGTGAGGAGTGAATGAG
TGGCCTTCTGATGCTCTGACTCTTCTCTGTATGTCAAACTCATCCCTGGCACAAGAAATT
CCAGTCATGTGAAGCAAACTGCCCTTTGTCCTCAAAGAAATTGTTGAAAAAGAAAACTTT
TTAAAGAGATTTTTTGCATATTCTCTGCCTTGTTCTTATCAACTTGAAATGTTGGCATTT
TCTAACCTTGTTTTGTTGGCTACAATAATTCAGTATTCATGTCAAAATTGAGAAGTGCCC
TAATTGAATGTGTTTGAATGTTATCCTTGCACAATTCTTTAAATTGAAAGATAAAATGTT
TTACCTCACTGTTGGACATACATTCCAAGCTTTTCAACTCTAGGAGAAAAAGAAAATCAT
GTTTTCCTGTATTGTAAATTTTAGACTATTTCATATACATTGTATTAAAACTGCCATATC
AATTTTAATGTATAGATTTTGCAAATATTATGCTATATGTAATACCTAACTGTATCTGTA
GTGTATATGTAATATATTTATGCCCAATAAATGTTTTAATTCTTTCTGACTTAAAAAAAA
AAAAAAA

Protein Sequence

>64778 : length: 1204
MYVTMMMTDQIPLELPPLLNGEVAMMPHLVNGDAAQQVILVQVNPGETFTIRAEDGTLQC
IQGPAEVPMMSPNGSIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECYPPSYPSAMSPT
HHLPPYLTHHPHFIHNSHTAYYPPVTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMSTY
ITREDQYSKPPHKKLKDRQIDRQNRLNSPPSSIYKSSCTTVYNGYGKGHSGGSGGGGSGS
GPGIKKTERRARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPPV
GLSCGPHSGLSFPYSYEVALSDKGRDGKYKIIYSGEELECNLKDLRPATDYHVRVYAMYN
SVKGSCSEPVSFTTHSCAPECPFPPKLAHRSKSSLTLQWKAPIDNGSKITNYLLEWDEGK
RNSGFRQCFFGSQKHCKLTKLCPAMGYTFRLAARNDIGTSGYSQEVVCYTLGNIPQMPSA
PRLVRAGITWVTLQWSKPEGCSPEEVITYTLEIQEDENDNLFHPKYTGEDLTCTVKNLKR
STQYKFRLTASNTEGKSCPSEVLVCTTSPDRPGPPTRPLVKGPVTSHGFSVKWDPPKDNG
GSEILKYLLEITDGNSEANQWEVAYSGSATEYTFTHLKPGTLYKLRACCISTGGHSQCSE
SLPVRTLSIAPGQCRPPRVLGRPKHKEVHLEWDVPASESGCEVSEYSVEMTEPEDVASEV
YHGPELECTVGNLLPGTVYRFRVRALNDGGYGPYSDVSEITTAAGPPGQCKAPCISCTPD
GCVLVGWESPDSSGADISEYRLEWGEDEESLELIYHGTDTRFEIRDLLPAAQYCCRLQAF
NQAGAGPYSELVLCQTPASAPDPVSTLCVLEEEPLDAYPDSPSACLVLNWEEPCNNGSEI
LAYTIDLGDTSITVGNTTMHVMKDLLPETTYRIRIQAINEIGAGPFSQFIKAKTRPLPPL
PPRLECAAAGPQSLKLKWGDSNSKTHAAEDIVYTLQLEDRNKRFISIYRGPSHTYKVQRL
TEFTCYSFRIQAASEAGEGPFSETYTFSTTKSVPPTIKAPRVTQLEGNSCEILWETVPSM
KGDPVNYILQVLVGRESEYKQVYKGEEATFQISGLQTNTDYRFRVCACRRCLDTSQELSG
AFSPSAAFVLQRSEVMLTGDMGSLDDPKMKSMMPTDEQFAAIIVLGFATLSILFAFILQY
FLMK