ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6446

Name

SGK1

Synonym

SGK;serum/glucocorticoid regulated kinase 1;SGK1;serum/glucocorticoid regulated kinase 1

Definition

Sgk1 variant i3|serine/threonine protein kinase SGK|serine/threonine-protein kinase Sgk1|serum/glucocorticoid-regulated kinase 1

Position

6q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Insulin Pathway;PID Curated;200012

Pathway

Glucocorticoid receptor regulatory network;PID Curated;200077

Pathway

Aldosterone-regulated sodium reabsorption;KEGG PATHWAY;hsa04960

Pathway

FoxO family signaling;PID Curated;200091

Pathway

mTOR signaling pathway;PID Curated;200080

Pathway

Class I PI3K signaling events;PID Curated;200098

Disease

Hyperglycemia;FunDO

Disease

Embryoma;FunDO

Disease

Pulmonary fibrosis;FunDO

Disease

Carcinoma;FunDO

Disease

Huntington disease;FunDO

Disease

CARDIOVASCULAR;GAD

Disease

Hyperinsulinism;FunDO

Disease

Glomerulonephritis;FunDO

Disease

blood pressure, arterial;GAD

Disease

Infertility;FunDO

Disease

Hypertension;FunDO

Disease

Diabetes Mellitus, Type 2;GAD

Disease

Breast cancer;FunDO

Disease

Kidney disease;FunDO

Disease

METABOLIC;GAD

External Links

Links to cell senescence gene database

6446

Links to epithelial mesenchymal transition gene database

6446

Links to ovarian cancer gene database

6446

Links to endometrial cancer gene database

6446

Links to iHOP

6446

Sequence Information

Nucleotide Sequence

>6446 : length: 3208
AGATATTCATGAACCGTTGCTTCTTCCAGCCTCGCCTTCTCGCTCCCTCTGCCTTTCTGG
CGCTGTTCTCCCTCCCTCCCTCTGGCTTCTGCTCTTTCTTACTCCTTCTCTCAGCTGCTT
AACTACAGCTCCCACTGGAACTTGCACAATCAAAAACAACTCTCCTCTCTCAAGCCGCCT
CCAGGAGCGCATCACCTGGAGAAGAGCGACTCGCTCCCCGCGCCGGCCGCGGAAGAGCAG
CCAGGTAGCTGGGGGCGGGGAGGCGTACCCTTCTCCCGCTCGGTAAGAGCCACAGCATCT
CCCCGGAGATTGGCCGTATCCCACCGTCCGGCCCCCAGGGTCCTGCAGCGGTGATGCATA
TGTTTCGGAGCAATGATGGAAGGAGAAAAGCCGCTGTCGGTGGCAACTGAAAGTGGGGAG
AGGTTGCTGCAGTAGCTGGTGCTGCAGAATGCGCGAGTGAAGAACTGAGCCCCGCTAGAT
TCTCCATCCCGCTCAGTCTTCATTAACTGTCTGCAGGAGGTAAACCGGGGAAACAGATAT
GCACTAACCAGGCGGGTGCCAACCTGGATCTATAACTGTGAATTCCCCACGGTGGAAAAT
GGTAAACAAAGACATGAATGGATTCCCAGTCAAGAAATGCTCAGCCTTCCAATTTTTTAA
GAAGCGGGTACGAAGGTGGATCAAGAGCCCAATGGTCAGTGTGGACAAGCATCAGAGTCC
CAGCCTGAAGTACACCGGCTCCTCCATGGTGCACATCCCTCCAGGGGAGCCAGACTTCGA
GTCTTCCTTGTGTCAAACATGCCTGGGTGAACATGCTTTCCAAAGAGGGGTTCTCCCTCA
GGAGAACGAGTCATGTTCATGGGAAACTCAATCTGGGTGTGAAGTGAGAGAGCCATGTAA
TCATGCCAACATCCTGACCAAGCCCGATCCAAGAACCTTCTGGACTAATGATGATCCAGC
TTTCATGAAGCAGAGGAGGATGGGTCTGAACGACTTTATTCAGAAGATTGCCAATAACTC
CTATGCATGCAAACACCCTGAAGTTCAGTCCATCTTGAAGATCTCCCAACCTCAGGAGCC
TGAGCTTATGAATGCCAACCCTTCTCCTCCACCAAGTCCTTCTCAGCAAATCAACCTTGG
CCCGTCGTCCAATCCTCATGCTAAACCATCTGACTTTCACTTCTTGAAAGTGATCGGAAA
GGGCAGTTTTGGAAAGGTTCTTCTAGCAAGACACAAGGCAGAAGAAGTGTTCTATGCAGT
CAAAGTTTTACAGAAGAAAGCAATCCTGAAAAAGAAAGAGGAGAAGCATATTATGTCGGA
GCGGAATGTTCTGTTGAAGAATGTGAAGCACCCTTTCCTGGTGGGCCTTCACTTCTCTTT
CCAGACTGCTGACAAATTGTACTTTGTCCTAGACTACATTAATGGTGGAGAGTTGTTCTA
CCATCTCCAGAGGGAACGCTGCTTCCTGGAACCACGGGCTCGTTTCTATGCTGCTGAAAT
AGCCAGTGCCTTGGGCTACCTGCATTCACTGAACATCGTTTATAGAGACTTAAAACCAGA
GAATATTTTGCTAGATTCACAGGGACACATTGTCCTTACTGACTTCGGACTCTGCAAGGA
GAACATTGAACACAACAGCACAACATCCACCTTCTGTGGCACGCCGGAGTATCTCGCACC
TGAGGTGCTTCATAAGCAGCCTTATGACAGGACTGTGGACTGGTGGTGCCTGGGAGCTGT
CTTGTATGAGATGCTGTATGGCCTGCCGCCTTTTTATAGCCGAAACACAGCTGAAATGTA
CGACAACATTCTGAACAAGCCTCTCCAGCTGAAACCAAATATTACAAATTCCGCAAGACA
CCTCCTGGAGGGCCTCCTGCAGAAGGACAGGACAAAGCGGCTCGGGGCCAAGGATGACTT
CATGGAGATTAAGAGTCATGTCTTCTTCTCCTTAATTAACTGGGATGATCTCATTAATAA
GAAGATTACTCCCCCTTTTAACCCAAATGTGAGTGGGCCCAACGACCTACGGCACTTTGA
CCCCGAGTTTACCGAAGAGCCTGTCCCCAACTCCATTGGCAAGTCCCCTGACAGCGTCCT
CGTCACAGCCAGCGTCAAGGAAGCTGCCGAGGCTTTCCTAGGCTTTTCCTATGCGCCTCC
CACGGACTCTTTCCTCTGAACCCTGTTAGGGCTTGGTTTTAAAGGATTTTATGTGTGTTT
CCGAATGTTTTAGTTAGCCTTTTGGTGGAGCCGCCAGCTGACAGGACATCTTACAAGAGA
ATTTGCACATCTCTGGAAGCTTAGCAATCTTATTGCACACTGTTCGCTGGAAGCTTTTTG
AAGAGCACATTCTCCTCAGTGAGCTCATGAGGTTTTCATTTTTATTCTTCCTTCCAACGT
GGTGCTATCTCTGAAACGAGCGTTAGAGTGCCGCCTTAGACGGAGGCAGGAGTTTCGTTA
GAAAGCGGACGCTGTTCTAAAAAAGGTCTCCTGCAGATCTGTCTGGGCTGTGATGACGAA
TATTATGAAATGTGCCTTTTCTGAAGAGATTGTGTTAGCTCCAAAGCTTTTCCTATCGCA
GTGTTTCAGTTCTTTATTTTCCCTTGTGGATATGCTGTGTGAACCGTCGTGTGAGTGTGG
TATGCCTGATCACAGATGGATTTTGTTATAAGCATCAATGTGACACTTGCAGGACACTAC
AACGTGGGACATTGTTTGTTTCTTCCATATTTGGAAGATAAATTTATGTGTAGACTTTTT
TGTAAGATACGGTTAATAACTAAAATTTATTGAAATGGTCTTGCAATGACTCGTATTCAG
ATGCTTAAAGAAAGCATTGCTGCTACAAATATTTCTATTTTTAGAAAGGGTTTTTATGGA
CCAATGCCCCAGTTGTCAGTCAGAGCCGTTGGTGTTTTTCATTGTTTAAAATGTCACCTG
TAAAATGGGCATTATTTATGTTTTTTTTTTTGCATTCCTGATAATTGTATGTATTGTATA
AAGAACGTCTGTACATTGGGTTATAACACTAGTATATTTAAACTTACAGGCTTATTTGTA
ATGTAAACCACCATTTTAATGTACTGTAATTAACATGGTTATAATACGTACAATCCTTCC
CTCATCCCATCACACAACTTTTTTTGTGTGTGATAAACTGATTTTGGTTTGCAATAAAAC
CTTGAAAAATATTTACATATAAAAAAAA

Protein Sequence

>6446 : length: 526
MVNKDMNGFPVKKCSAFQFFKKRVRRWIKSPMVSVDKHQSPSLKYTGSSMVHIPPGEPDF
ESSLCQTCLGEHAFQRGVLPQENESCSWETQSGCEVREPCNHANILTKPDPRTFWTNDDP
AFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINL
GPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMS
ERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAE
IASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLA
PEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSAR
HLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHF
DPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL