ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

64400

Name

AKTIP

Synonym

FT1|FTS;AKT interacting protein;AKTIP;AKT interacting protein

Definition

AKT-interacting protein|fused toes homolog

Position

16q12.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

64400

Links to epithelial mesenchymal transition gene database

64400

Links to ovarian cancer gene database

64400

Links to endometrial cancer gene database

64400

Links to iHOP

64400

Sequence Information

Nucleotide Sequence

>64400 : length: 2525
AGGGGGCGGAGCCCGCTGCCGAGGGCAGGGCAGGGCAGGGCAGGGCGGGGTGGGGCGGGG
CGGGGATCAAGCAGGGGCAGGGCTGGCGCTGCGGCGGGAGATGCTGTCGGGCCGCGGCGG
CGCTTGGCAGCCAGGAGCTCTGCATTGAAGGCACTGGGGTGAGGCTTACTGCCCGGCAGG
CTGGTGGGTAAAGTGAATGCCGAAGACAGAAGATTTGGATGATACACCACTGACTTTCTT
TGTTTGGAATACACGTTATGAACCCTTTCTGGAGCATGTCTACAAGCTCTGTACGCAAAC
GATCTGAAGGTGAAGAGAAGACATTAACAGGGGACGTGAAAACCAGTCCTCCACGAACTG
CACCAAAGAAACAGCTGCCTTCTATTCCCAAAAATGCTTTGCCCATAACTAAGCCTACAT
CTCCTGCCCCAGCAGCACAGTCAACAAATGGCACGCATGCGTCCTATGGACCCTTCTACC
TGGAATACTCTCTTCTTGCAGAATTTACCTTGGTTGTGAAGCAGAAGCTACCAGGCGTCT
ATGTGCAGCCATCTTATCGCTCTGCATTAATGTGGTTTGGAGTAATATTCATACGGCATG
GACTTTACCAAGATGGCGTATTTAAGTTTACAGTTTACATCCCTGATAACTATCCAGATG
GTGACTGTCCACGCTTGGTGTTCGATATTCCTGTCTTTCACCCGCTAGTTGATCCCACCT
CAGGTGAGCTGGATGTGAAGAGAGCATTTGCAAAATGGAGGCGGAACCATAATCATATTT
GGCAGGTATTAATGTATGCAAGGAGAGTTTTCTACAAGATTGATACAGCAAGCCCCCTGA
ACCCAGAGGCTGCAGTACTGTATGAAAAAGATATTCAGCTTTTTAAAAGTAAAGTTGTTG
ACAGTGTTAAGGTGTGCACTGCTCGTTTGTTTGACCAACCTAAAATAGAAGACCCCTATG
CAATTAGCTTTTCTCCATGGAATCCTTCTGTACATGATGAAGCCAGAGAAAAGATGCTGA
CTCAGAAAAAGCCTGAAGAACAGCACAATAAAAGTGTTCATGTTGCTGGCCTGTCATGGG
TAAAGCCTGGCTCAGTACAGCCTTTCAGTAAAGAAGAGAAAACAGTGGCGACTTAAGAGA
TGGTGAATCTGGTGCACCATGCACTTTCCTGCTAGACTCTGGCCTAGTTCAAGCTGACCA
ATGGCAGAGGACTGCCTGAAGAGTAAAACTGTGTGAACAATGACTGACTGCCAGTGTTTT
CCATGTATGCATAGGTTCTAACAGCAGGGTTTGGAAACCTGTCTCTAAGTAATGCATTAC
TTCTGTCAGAAGTGTCTTAGGGTGGTTATCTAGTTCAGTACTCCAAATTATTGGGGACCT
TGAGGCTTAAGTAAGTATTTTTCTGAATATAATGCTAAAGGTAAGTTGCATTCATTTAAA
CTAATAGAGCAGACAGAATTCAGCACTACTTAATAGTTTATAAATCAGTGGTTTCAGTTG
TATATATGTTAGGAAATGGAGAGGTATAGAGAGAGCAGGTTCCATAGCTCAGCACTTTTA
AGTGGAAGATCATTTGAATCTCAGTCTTCAGCCTGCACTGATTTGTAGCCTGCACTGTCT
TACTGATTTACAAACTGAAATCACTGAGAAATGTCTTTAGTTCAGTGAGAAGAAACCAGA
ACACTTGTTCCTAGTGTTGTGTTGTTTTTTTTAAGCAAATTACTTACTGTATTTTTATGG
CAGGAGGGAGAAAAAGTGTTACAACGGTTTCTAATGAAGTCCGGTATTTAAATGATAAAT
GACTAATGTGTTTAGTAGAGACAAAATAAACCAATAAATGATTGTTCTTTGCCATTTATG
CAGGAAACTACCCTTTTCTCAATATAACCAAACAAAGGCTAATTTATAAATGCTTTATTG
AAAAATACACTTATCTTCATATAAAATTACAGTAGCAGTATCTTGAGAAGTTTTATAAAT
ATTTTTGCAGAACACTATTCTAATTGAACAATGTAAGTTCCATATTTCTCTCAGCAATAT
GAAGTTACCTAGTAACTTTGTTTATACTGATTCAATTTACAATTGAATTTTCTCCCTAAT
AAGATTATTAATTTGACTTGAAAACTGCTGGAACAATAGTGATTAATAAAGATATGTATA
GATAATTCAGCTGTTAAATAACATTTTCTAATTTGTATAAATGGTACTATGGTACTAATA
AAAACCTAAATTCTCCAACCAATTTTTTTAAACTGCCAGGAACACCCAAAAATATTTTTA
AATATATCACCTTAATAGACATTTCTTTTAGATAACTCCCTCCTAAAGGAAGAGGTCATA
AGTTTTCATATTAATCCCCTCAATTCAACTTGATTAAAATCTTTTCTTAGCTGGTTGATC
CCTATATAACAAAAAACTGGAGAATTTAAAACATTCCCAAAAGGTGGCTATAGGGGTTTT
AACATTTTAAAAAAATATAAAAGCATTAAAGAAAATATTGGATGTTTAAAAAAAAAAAAA
AAAAA

Protein Sequence

>64400 : length: 293
MNPFWSMSTSSVRKRSEGEEKTLTGDVKTSPPRTAPKKQLPSIPKNALPITKPTSPAPAA
QSTNGTHASYGPFYLEYSLLAEFTLVVKQKLPGVYVQPSYRSALMWFGVIFIRHGLYQDG
VFKFTVYIPDNYPDGDCPRLVFDIPVFHPLVDPTSGELDVKRAFAKWRRNHNHIWQVLMY
ARRVFYKIDTASPLNPEAAVLYEKDIQLFKSKVVDSVKVCTARLFDQPKIEDPYAISFSP
WNPSVHDEAREKMLTQKKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVAT