ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

64324

Name

NSD1

Synonym

ARA267|KMT3B|SOTOS|SOTOS1|STO;nuclear receptor binding SET domain protein 1;NSD1;nuclear receptor binding SET domain protein 1

Definition

H3-K36-HMTase|H4-K20-HMTase|NR-binding SET domain-containing protein|androgen receptor coactivator 267 kDa protein|androgen receptor-associated coregulator 267|androgen receptor-associated protein of 267 kDa|histone-lysine N-methyltransferase, H3 lysine-3

Position

5q35

Gene Type

protein-coding

Pathways and Diseases

Pathway

Lysine degradation;KEGG PATHWAY;hsa00310

Disease

Autistic disorder;FunDO

Disease

Mental retardation;FunDO

Disease

congenital anomalies;GAD

Disease

Leukemia, acute myeloid;OMIM

Disease

DEVELOPMENTAL;GAD

Disease

Beckwith-Wiedemann syndrome;FunDO

Disease

Leukemia;FunDO

Disease

Weaver syndrome;OMIM

Disease

Beckwith-Wiedemann syndrome;OMIM

Disease

Attention deficit hyperactivity disorder;FunDO

Disease

Sotos syndrome;OMIM

External Links

Links to cell senescence gene database

64324

Links to epithelial mesenchymal transition gene database

64324

Links to ovarian cancer gene database

64324

Links to endometrial cancer gene database

64324

Links to iHOP

64324

Sequence Information

Nucleotide Sequence

>64324 : length: 12998
GACGCGGGGGGAGGGGGGTGCGGCGAGCGGCCCCGCTCTCTCCCCACCGCTCCGCTCGCA
CCCCAGTGTAATGAGGGTCACCCCCTCCCCCCAGCTGGCCCGGGAGGGGGCGCGGGGCAC
GGTTGATGCCGGCCCAGGATGGATCAGACCTGTGAACTACCCAGAAGAAATTGTCTGCTG
CCCTTTTCCAATCCAGTGAATTTAGATGCCCCTGAAGACAAGGACAGCCCTTTCGGTAAT
GGTCAATCCAATTTTTCTGAGCCACTTAATGGGTGTACTATGCAGTTATCGACTGTCAGT
GGAACATCCCAAAATGCTTATGGACAAGATTCTCCATCTTGTTACATTCCACTGCGGAGA
CTACAGGATTTGGCCTCCATGATCAATGTAGAGTATTTAAATGGGTCTGCTGATGGATCA
GAATCCTTTCAAGACCCTGAAAAAAGTGATTCAAGAGCTCAGACGCCAATTGTTTGCACT
TCCTTGAGTCCTGGTGGTCCTACAGCACTTGCTATGAAACAGGAACCCTCTTGTAATAAC
TCCCCTGAACTCCAGGTAAAAGTAACAAAGACTATCAAGAATGGCTTTCTGCACTTTGAG
AATTTTACTTGTGTGGACGATGCAGATGTAGATTCTGAAATGGACCCAGAACAGCCAGTC
ACAGAGGATGAGAGTATAGAGGAGATCTTTGAGGAAACTCAGACCAATGCCACCTGCAAT
TATGAGACTAAATCAGAGAATGGTGTAAAAGTGGCCATGGGAAGTGAACAAGACAGCACA
CCAGAGAGTAGACACGGTGCAGTCAAATCGCCATTCTTGCCATTAGCTCCTCAGACTGAA
ACACAGAAAAATAAGCAAAGAAATGAAGTGGACGGCAGCAATGAAAAAGCAGCCCTTCTC
CCAGCCCCCTTTTCACTAGGAGACACAAACATTACAATAGAAGAGCAATTAAACTCAATA
AATTTATCTTTTCAGGATGATCCAGATTCCAGTACCAGTACATTAGGAAACATGCTAGAA
TTACCTGGAACTTCATCATCATCTACTTCACAGGAATTGCCATTTTGTCAACCTAAGAAA
AAGTCTACGCCACTGAAGTATGAAGTTGGAGATCTCATCTGGGCAAAATTCAAGAGACGC
CCATGGTGGCCCTGCAGGATTTGTTCTGATCCGTTGATTAACACACATTCAAAAATGAAA
GTTTCCAACCGGAGGCCCTATCGGCAGTACTACGTGGAGGCTTTTGGAGATCCTTCTGAG
AGAGCCTGGGTGGCTGGAAAAGCAATCGTCATGTTTGAAGGCAGACATCAATTCGAAGAG
CTACCTGTCCTTAGGAGAAGAGGGAAACAGAAAGAAAAAGGATATAGGCATAAGGTTCCT
CAGAAAATTTTGAGTAAATGGGAAGCCAGTGTTGGACTTGCAGAACAGTATGATGTTCCC
AAGGGGTCAAAGAACCGAAAATGTATTCCTGGTTCAATCAAGTTGGACAGTGAAGAAGAT
ATGCCATTTGAAGACTGCACAAATGATCCTGAGTCAGAACATGACCTGTTGCTTAATGGC
TGTTTGAAATCACTGGCTTTTGATTCTGAACATTCTGCAGATGAGAAGGAAAAGCCTTGC
GCTAAATCTCGAGCCAGAAAGAGCTCTGATAATCCAAAAAGGACTAGTGTGAAAAAGGGC
CACATACAATTTGAAGCACATAAAGATGAACGGAGGGGAAAGATTCCAGAGAACCTTGGC
CTAAACTTTATCTCTGGGGATATATCTGATACGCAGGCCTCTAATGAACTTTCCAGGATA
GCAAATAGCCTCACAGGGTCCAACACTGCCCCAGGAAGTTTTCTGTTTTCTTCCTGTGGA
AAAAACACTGCAAAGAAAGAATTTGAGACTTCAAATGGTGACTCTTTATTGGGCTTGCCT
GAGGGTGCTTTGATCTCAAAGTGTTCTCGAGAGAAGAATAAACCCCAACGAAGCCTGGTG
TGTGGTTCAAAAGTGAAGCTCTGCTATATTGGAGCAGGTGATGAGGAAAAGCGAAGTGAT
TCCATTAGTATCTGTACCACTTCTGATGATGGAAGCAGTGACCTGGATCCCATAGAACAC
AGCTCAGAGTCTGATAACAGTGTCCTTGAAATTCCAGATGCTTTCGATAGAACAGAGAAC
ATGTTATCTATGCAGAAAAATGAAAAGATAAAGTATTCTAGGTTTGCTGCCACAAACACT
AGGGTAAAAGCAAAACAGAAGCCTCTCATTAGTAACTCACATACAGACCACTTAATGGGT
TGTACTAAGAGTGCAGAGCCTGGAACCGAGACGTCTCAGGTTAATCTCTCTGATCTGAAG
GCATCTACTCTTGTTCACAAACCCCAGTCAGATTTTACAAATGATGCTCTCTCTCCAAAA
TTCAACCTGTCATCAAGCATATCCAGTGAGAACTCGTTAATAAAGGGTGGGGCAGCAAAT
CAAGCTCTATTACATTCGAAAAGCAAACAGCCCAAGTTCCGAAGTATAAAGTGCAAACAC
AAAGAAAATCCAGTTATGGCAGAACCCCCAGTTATAAATGAGGAGTGCAGTTTGAAATGC
TGCTCTTCTGATACCAAAGGCTCTCCTTTGGCCAGCATTTCTAAAAGTGGGAAAGTGGAT
GGTCTAAAACTACTGAACAATATGCATGAGAAAACCAGGGATTCAAGTGACATAGAAACA
GCAGTGGTGAAACATGTTTTATCCGAGTTGAAGGAACTCTCTTACAGATCCTTAGGTGAG
GATGTCAGTGACTCTGGAACATCAAAGCCATCAAAACCATTACTTTTCTCTTCTGCTTCT
AGTCAGAATCACATACCTATTGAACCAGACTACAAATTCAGTACATTGCTAATGATGTTG
AAAGATATGCATGATAGTAAGACGAAGGAGCAGCGGTTGATGACTGCTCAAAACCTGGTC
TCTTACCGGAGTCCTGGTCGTGGGGACTGTTCTACTAATAGTCCTGTAGGAGTCTCTAAG
GTTTTGGTTTCAGGAGGCTCCACACACAATTCAGAGAAAAAGGGAGATGGCACTCAGAAC
TCCGCCAATCCTAGCCCTAGTGGGGGTGACTCTGCATTATCTGGCGAGTTGTCTGCTTCC
CTACCTGGCTTACTGTCCGACAAGAGAGACCTCCCTGCTTCTGGTAAAAGTCGTTCAGAC
TGTGTTACTAGGCGCAACTGTGGACGATCAAAGCCTTCATCCAAATTGCGAGATGCTTTT
TCAGCCCAAATGGTAAAGAACACAGTGAACCGTAAAGCCTTAAAGACCGAGCGCAAAAGA
AAACTGAATCAGCTTCCAAGTGTGACTCTTGATGCTGTACTGCAGGGAGACCGAGAACGT
GGAGGTTCATTGAGAGGTGGGGCAGAAGATCCTAGTAAAGAGGATCCCCTTCAGATAATG
GGCCACTTAACAAGTGAAGATGGTGACCATTTTTCTGATGTGCATTTCGATAGCAAGGTT
AAGCAATCTGATCCTGGTAAAATTTCTGAAAAAGGACTCTCTTTTGAAAACGGAAAAGGC
CCAGAGCTGGACTCTGTAATGAACAGTGAGAATGATGAACTCAATGGTGTAAATCAAGTG
GTGCCTAAAAAGCGGTGGCAGCGTTTAAACCAAAGGCGCACTAAACCTCGTAAGCGCATG
AACAGATTTAAAGAGAAAGAAAACTCTGAGTGTGCCTTTAGGGTCTTACTTCCTAGTGAC
CCTGTGCAGGAGGGGCGGGATGAGTTTCCAGAGCATAGAACTCCTTCAGCAAGCATACTT
GAGGAACCACTGACAGAGCAAAATCATGCTGACTGCTTAGATTCAGCTGGGCCACGGTTA
AATGTTTGTGATAAATCCAGTGCCAGCATTGGTGACATGGAAAAGGAGCCAGGAATTCCC
AGTTTGACACCACAGGCTGAGCTCCCTGAACCAGCTGTGCGGTCAGAGAAGAAACGCCTT
AGGAAGCCAAGCAAGTGGCTTTTGGAATATACAGAAGAATATGATCAGATATTTGCTCCT
AAGAAAAAACAAAAGAAGGTACAGGAGCAGGTGCACAAGGTAAGTTCCCGCTGTGAAGAG
GAAAGCCTTCTAGCCCGAGGTCGATCTAGTGCTCAGAACAAGCAGGTGGACGAGAATTCT
TTGATTTCAACCAAAGAAGAGCCTCCAGTTCTTGAAAGGGAGGCTCCGTTTTTGGAGGGC
CCCTTGGCTCAGTCAGAACTTGGAGGTGGACATGCTGAGTTGCCGCAGCTGACCTTGTCT
GTGCCTGTGGCTCCGGAAGTCTCTCCACGGCCTGCCCTTGAGTCTGAGGAATTGCTAGTT
AAAACGCCAGGAAATTATGAAAGTAAACGTCAAAGAAAACCAACTAAGAAACTTCTTGAA
TCCAATGATTTAGACCCTGGATTTATGCCCAAGAAGGGGGACCTTGGCCTTTCTAAAAAG
TGCTATGAAGCTGGTCACCTGGAGAATGGCATAACTGAATCTTGTGCCACATCTTATTCA
AAAGATTTTGGTGGAGGCACTACCAAGATATTTGACAAGCCAAGGAAGCGAAAACGACAG
AGGCATGCTGCAGCCAAGATGCAGTGTAAAAAAGTGAAAAATGATGACTCGTCAAAAGAG
ATTCCAGGCTCAGAGGGAGAACTAATGCCTCACAGGACGGCCACAAGCCCCAAGGAGACT
GTTGAGGAAGGTGTAGAACACGATCCCGGGATGCCTGCCTCTAAAAAAATGCAGGGTGAA
CGCGGTGGAGGAGCTGCACTCAAGGAGAATGTCTGTCAGAATTGTGAAAAATTGGGTGAG
CTGCTGTTATGTGAGGCTCAGTGCTGTGGGGCTTTCCACCTGGAGTGCCTTGGATTGACT
GAGATGCCAAGAGGAAAATTTATCTGCAATGAATGTCGCACAGGAATCCATACCTGTTTT
GTATGTAAGCAGAGTGGGGAAGATGTTAAAAGGTGCCTTCTACCCTTGTGTGGAAAGTTT
TACCATGAAGAGTGTGTCCAGAAGTACCCACCCACTGTTATGCAGAACAAGGGCTTCCGG
TGCTCCCTCCACATCTGTATAACCTGTCATGCTGCTAATCCAGCCAATGTTTCTGCATCT
AAAGGTCGGTTGATGCGCTGTGTCCGCTGTCCTGTGGCATACCACGCCAATGACTTTTGC
CTGGCTGCTGGGTCAAAGATCCTTGCATCTAATAGTATCATCTGCCCTAATCACTTTACC
CCTAGGCGGGGCTGCCGAAATCATGAGCATGTTAATGTTAGCTGGTGCTTTGTGTGCTCA
GAAGGAGGCAGCCTTCTGTGCTGTGATTCTTGCCCTGCTGCTTTTCATCGTGAATGCCTG
AACATTGATATCCCTGAAGGAAACTGGTATTGCAATGACTGTAAAGCAGGCAAAAAGCCA
CACTACAGGGAGATTGTCTGGGTAAAAGTTGGACGATACAGGTGGTGGCCAGCTGAGATC
TGCCATCCTCGAGCTGTTCCTTCCAACATTGATAAGATGAGACATGATGTGGGAGAGTTC
CCAGTCCTCTTTTTTGGATCTAATGACTATTTGTGGACTCACCAGGCCCGAGTCTTCCCT
TACATGGAGGGTGACGTGAGCAGCAAGGATAAGATGGGCAAAGGAGTGGATGGGACATAT
AAAAAAGCTCTTCAGGAAGCTGCAGCAAGGTTTGAGGAATTAAAGGCCCAAAAAGAGCTA
AGACAGCTGCAGGAAGACCGAAAGAATGACAAGAAGCCACCACCTTATAAACATATAAAG
GTAAACCGTCCTATTGGCAGGGTACAGATCTTCACTGCAGACTTATCTGAAATACCCCGT
TGCAACTGTAAAGCTACTGATGAGAACCCCTGTGGGATAGACTCTGAATGCATCAACCGC
ATGCTGCTCTATGAGTGCCACCCCACAGTGTGTCCTGCCGGAGGGCGCTGTCAAAACCAG
TGCTTTTCCAAGCGCCAATATCCAGAGGTTGAAATTTTCCGCACATTACAGCGGGGTTGG
GGTCTACGGACAAAAACAGATATTAAAAAGGGTGAATTTGTGAATGAGTATGTGGGTGAG
CTTATAGATGAAGAAGAATGCAGAGCTCGAATTCGCTATGCTCAAGAACATGATATCACT
AATTTCTATATGCTCACCCTAGACAAAGACCGAATCATTGATGCTGGTCCCAAAGGAAAC
TATGCTCGGTTCATGAATCATTGCTGCCAGCCCAACTGTGAAACACAGAAGTGGTCTGTG
AATGGAGATACCCGTGTAGGCCTTTTTGCACTAAGTGACATTAAAGCAGGCACTGAACTT
ACCTTCAACTACAACCTAGAATGTCTTGGGAATGGAAAGACTGTTTGCAAATGTGGAGCC
CCGAACTGCAGTGGCTTCTTGGGTGTAAGGCCAAAGAATCAACCCATTGCCACGGAAGAA
AAGTCAAAGAAATTCAAGAAGAAGCAACAGGGAAAGCGCAGGACCCAGGGTGAAATCACA
AAGGAGCGAGAAGATGAGTGTTTTAGTTGTGGGGATGCTGGCCAGCTCGTCTCCTGCAAG
AAACCAGGCTGCCCAAAAGTTTACCACGCAGACTGTCTCAATCTGACCAAGCGACCAGCA
GGGAAATGGGAATGTCCGTGGCATCAGTGTGACATCTGCGGGAAGGAAGCAGCCTCCTTC
TGTGAGATGTGCCCCAGCTCCTTTTGTAAGCAGCATCGAGAAGGGATGCTTTTCATTTCC
AAACTGGATGGGCGTCTGTCTTGTACTGAGCATGACCCCTGTGGGCCCAATCCTCTGGAA
CCTGGGGAGATCCGTGAGTATGTGCCTCCCCCAGTACCGCTGCCTCCAGGGCCAAGCACT
CACCTGGCAGAGCAATCAACAGGAATGGCTGCTCAGGCACCCAAAATGTCAGATAAACCT
CCTGCTGACACCAACCAGATGCTGTCGCTCTCCAAAAAAGCTCTGGCAGGGACTTGTCAG
AGGCCATTGCTACCTGAAAGACCTCTTGAGAGAACTGACTCCAGGCCCCAGCCTTTAGAT
AAGGTCAGAGACCTCGCTGGGTCAGGGACCAAATCCCAATCCTTGGTTTCCAGCCAGAGG
CCACTGGACAGGCCACCAGCAGTGGCAGGACCAAGACCCCAGCTAAGCGACAAACCCTCT
CCAGTGACCAGCCCAAGCTCCTCACCCTCAGTCAGGTCCCAACCACTGGAAAGACCTCTG
GGGACGGCTGACCCAAGGCTGGATAAATCCATAGGTGCTGCCAGCCCAAGGCCCCAGTCA
CTGGAGAAAACCTCAGTTCCCACTGGCCTGAGACTTCCGCCGCCAGACAGACTGCTCATT
ACTAGCAGTCCCAAACCCCAGACTTCAGACAGGCCTACTGACAAACCCCATGCCTCTTTG
TCCCAGAGACTCCCACCTCCTGAGAAAGTACTATCAGCTGTGGTCCAGACCCTTGTAGCT
AAAGAAAAAGCACTGAGGCCTGTGGACCAGAATACTCAGTCAAAAAATAGAGCTGCTTTG
GTGATGGATCTCATAGACCTAACTCCTCGCCAGAAGGAGCGGGCAGCTTCACCTCATCAG
GTCACACCACAGGCTGATGAGAAGATGCCAGTGTTGGAGTCAAGTTCATGGCCTGCCAGC
AAAGGTCTGGGGCATATGCCGAGAGCTGTTGAGAAAGGCTGTGTGTCAGATCCTCTTCAG
ACATCTGGGAAAGCAGCAGCCCCTTCAGAGGACCCCTGGCAAGCTGTTAAATCACTCACC
CAGGCCAGACTTCTTTCTCAGCCTCCTGCCAAGGCCTTTTTATATGAGCCAACAACTCAG
GCCTCAGGAAGAGCTTCTGCAGGGGCTGAGCAGACCCCAGGGCCTCTTAGCCAATCCCCG
GGCCTGGTGAAGCAGGCGAAGCAGATGGTCGGAGGCCAGCAACTACCTGCACTTGCCGCC
AAGAGTGGGCAATCTTTTAGGTCTCTCGGGAAGGCCCCAGCCTCCCTCCCCACTGAAGAA
AAGAAGTTGGTAACCACAGAGCAAAGTCCCTGGGCCCTGGGAAAAGCCTCATCACGGGCA
GGGCTCTGGCCCATAGTGGCTGGACAGACACTGGCACAGTCTTGCTGGTCTGCTGGGAGC
ACACAGACATTGGCACAGACTTGCTGGTCTCTTGGAAGAGGGCAAGACCCCAAACCAGAG
CAAAATACACTTCCAGCTCTTAACCAGGCTCCTTCCAGTCACAAGTGTGCAGAATCAGAA
CAGAAGTAGTACCAATCAATGTCACATGAACAAACAAGCTGCCCCCAGGGTACCATTTGG
GGAGGGGAAATCTTTTCTTTCTTTCCCCCTTAAAAAAAAACACATCTGCCCCGAACACTT
TCCCACTGTTATTCTTTCCTCATATCCCAACACTCAGAACTCTTGTGACATTAGCCAGTG
GGGGCTTATGGTTGTGTGAACCATGTATGAAAATCCAGTGGGCCCCAACCAAGGAGACAG
ACAGACTTGGGTCTCTTTCCCCCAACTTTTCCACATGGTCATCGTGAAATAAAAAGTCCA
CTCTGGAGTCAAGTATGGAATTCAATTCCGCTGGTCAGGTTGGAAGGTATAGGGGCTCTC
AAAGCGATTTCCCCAACCAGACAGAGCCCCATTGAGGGCACCTAGGAACCCTTGGGAGGA
AATGGTGTTCTTTCAAATCAGTGGCGATTTCCTGAGCATTCACGTGTTCTAGGCCGGGTG
CTAGTCACTGATGAGAGATACAGGCCTCATCCCTGTGAGCCTGGATTCCAAGGCTTTCAG
GAACCTTTGACCAGGAAGTAACAGGAAGTTCTGAGGGGCCCTGGGGCTTTAGACTCATTT
TGAAATGTCCTTTGTGGCACCAGAAGTGGTTGTGTTGAGGAAGTGTCTCTTGGCTGCGGT
GTGCATGGGTGCGTGTGCATGCGCGCACACTCACAGAGGTCTCCTCTATAGATGCAAGGG
TGCTGCATTGAGGCCAGCAAGGCTGTTGGCTGTGGGGTCGCCGCTGCTGCTTTTGTCTGG
GCTGTGCAGAGTCTCAAGATCAGTCCTTGGAGGAGCAGGTGGTCAGGGGCAGTCGGGCTC
TGTGCGAATGTAGATTTCCAGCAGTGGAAGAAGGCATTTGGCAAGCTTCTCTTTCTTTGC
TTTTGTTTCTACCTATTTTTCTCTTTGTACATGAATCCACCCCATCCCTATTTCCCTAAA
ACACTCAGGTGCTTTCAGATTTCAGAGCCTCGGGCAGTGGACATAGGGAATCTCTGGCAA
GCTCTGAGCTAGACACACCAGCTTCAGGAAGAGTACCAGATCCTGATGGGAAATTTCTTT
TCCCCATTCCTTTTCCCTCCTGAGTGGAGGGAGTCCTCTTCTTCGCCTCCCTGAGAATTG
CTGTGCTCTGTATTGAGAGCACCTGCCTGCTGACTTAGCTCAAAGGCAAGCCAGAACCCT
TCCCTGAAGACTGGCAAGAGGTGGTGTTTAGAGCAACGTCCAGGCTAAGAGATGACTCCT
ATTAACTGCTGATTATCTGTTACTGCTGCCCTGAGCTGGGGCCCAAGGGCTGGGAAATCT
GTTGGTGCTACCCTGCCCTACCATTCACCCAGCTCACAGACTGCCAACAGGAAGTGCTGT
TTGGCTAGTTTCCTCCCACTTGTCTACCCCTCCTTTGTCCTTAGACCAACATGTTTACCT
CTCTGCTTTGCCAACTTAGCCAGCAGGCCATCCCCGGCCCTAACGTCTCCTGGCCATTAT
CTCTTAGTTATGGCTTTCACGCTCTCAATAGGATTCTGTATTTGGTCCCAATTTCCTCAA
GTTCTTATTGAGGTTACTCCCATCAATTCCACGGAGGGAACAGTAGTTATTATAGAAGCA
TTTGCGCTTTATCTAAAGATTAAAAATAGAATCTGCTTTTATTTCCCAAAGTCTGTCTCT
GAGGTTGAGACACTTGAACTCAGGCAGAGGGACGAGGCTGGGCAGGGCTGTCCTGAGTTT
AGGGGCCTATCCCTGCATTTCACTGAGACCTCGGAATCTCCTCTGTGAATTCCACCTGCC
TAGTTCTCCCCTTTCATCCTCTCTCTCTTCCCACATCATCAAAGAGGAAAAGCTCTTTGT
TCAAAAGGAAGAGAAAACGTAAAGCATCTTATTTTCTTTTAAAAGAATTTTAAACCATGA
AAAAGATATTTTTAAAGAAATTCACCGAGAACATTAAAGTTCATTATATTAAGTATTTAT
CATGTGTGAGAATAATAAATATATAACTGCAGCTAGTAGGTCCCTTTCCCTAATCTTTTA
GGTCATATGAGTAGGGTTTGCTTGGTGCCAGTCCTGTGCCCTTTTCTCTCCAGTCATCTG
TAGTTGTGATCAGAAAAAGGTATCTGCACTGCACTGTCAGAGTCTCCTTTCACTATGTTG
TGTGTTAAATTACCGTAGCTCTTTGTTTCATGAAATAAACTGTGAATTTGGGGGGGGCGG
GGGGAGGGCGTGCAGGCCATGTAAAAATTTTCCGTGGAGAAGTTTGATTCTAAAGTAGCT
TCTCTAAAGTAGGCTTTGGTAGGTAATCAACTTGACAGCAGTCTAGATGTCTCACAGGAC
AGGAGGGAGTGAGGGAAAGGGGCCATGATTGGCTGCTTTGTGGTTTTATTTTGGTTCTTT
CCATTCTCCGCCATTCATTGGAGGCTTCGTTCCAGACCTGCCTGGGAAAACAGCTTCTGA
GCCATTTTGGGGAGCAGTTCTTCATCTGAATGGATGGACATCTGGGCTTCCTTCAAGGGC
CATTGAATGGGAACTAGAAAACCACTGGAAACTAGAAATTTGAGCTATTGGGCCCACCAG
TAGCAGCATGTGATACTAGATGGTTAAAATCATGAAAGCAGTCACTATCCAATTAGAAGC
AGAGTCACAACAACTGTTGGGAAATGTGACTCTTGGAGGAAGGTGGGGAGGGAGTGGCCT
TGCCAGCCCTGTGGGACGTCCCCTGAAGTTTGTAATAAGACCCCTTTTCCAAAGGGATGT
GAATTGGAGTGAAAAGGAAATCTTTCATCTTAGAAAACTTCTGGTCCTTAACGCAGGGTG
GTATTTGGGTATGTGCTTGGAAATTGAGATCTCAAGAGTGTTTGCCTTGGAGCCAGCTCC
CCAGGAGGCCTTTTCCAGGGACAAGGCAAAAGTTGAAATTCTCCATGGGTAGCTAGAAAG
CCAATACATCTAGCCCTGCTAAGTCAGAAAAAGATTATGAAAAATGTTGAAATTTACATT
CAAAGCCTCATTTGCTTATCTTGCTGGAGCCAACCCAGTCTAATAGCAAAATAGCTGTCA
TTGATACAGAAACATCCTCATTTTTAAATGTCTGCTTTACCCTGTTACTGAGTTTGAGAT
GACTTAAATCACTGTGTTGACCCTCTTCTGAACCAAATCTTTAGCATTGATGAAAATAGT
TATTTTATTCTTTACATCCTTCACCCCACACTATGGTCAGGGCATGAAACACCCTGTTGA
TCCCTTCCCAGGCTCGGCACTGTCTGCTCACTGGAGCCGGACTCCCAGGTTGTAATTCTA
ATGTTGCCTCATGAGAACAGAATGGCAGAAAGTTTAGTCCTGACAGATTCCCCCATAGGG
AGTAATGAGGACAGCATGAAACTTGGATAGGTTTTACCCTTAGTCCCTATAAGGTGGATT
TTACTAAGGTTTTTTAAATGATACTGTCATCCTCTTGGGGTTTATCAGCCAGGTTAGAGG
AGCCCAGTGTCCTAACCTCTCTCAGATCATGGCAGAGAAGGAGCTGCCTCCAGCCCCTTT
CTTGCTGAGTTTCATTTGAGCAGTTCCATGTGTAGACATTCCAAGTCACTGCTTGGTAGT
TGCTGTGGGAGCCTGTCATTGGCTATGGCCAGTTAGTTCTCAGCTGAGCTTCCTAGGGCC
AGTGCAACAGGGCCAGAGGCTGCTATAGTGTAAATTGAAATAAGAATAGATCATTGTTTT
GTACACACACACAATAAAATGTAATGATGGTGCTAATTTCACGGTATAAATAAGCACTGC
CAAGGGTTGAGGGACTGGCAGCTCAAGAAACCCGGGTTCCTGTTTGGGAGGAGATTTTAT
GTAGAAAAGTTTGAGGCTTTGTTAAAAGTGGGGAGAAGGAAGATCCTCAGTGAAGCCTGC
ACCCAACCCTGGAGTGGCCCAGTGCAATCCAGAGGTGGAAGAGATCCTATATCCAGGTGA
AGGTGGCCATTGAGTTTCTCAGGGCTGGGGCCACCTTGTCCATAGCCTCCGTCCACGCTG
CCTGGAGCAGGTTGTTAGAGAGCTCTGGTTGTTGGGTCTTCCTCAGCTCCCTTCTGCCCC
TCTCTACCTCTTCCACTCATGGAAGCCCCTCTACTGCTTATGAAGATTAAGGGTAGTATT
TTCTAAGGAAGTGGAAAGAATTAAACTAGAAATCCACAACCTCGGAAGAAGTGTTTCGAG
TTTAACATGCGCTGTTTCTGCTTATGTGGTTCCTTCTCTAGAGCTGCTTTCCCATGGCTT
TCAAAACATCAGGTTATTGTGGGGCTTCAGGTGTAAGGTCCTGGAAGTTCAGCAAAGTTT
CGTGGACAAGACATGGGCACAGAGAGTAGAAGCAGAAATAAATGGTTCTATGTTTTCAAC
TTCCAGGGTTGGGGCAGGCCAGAGCAAGGCGGTCTCATCGAGGTGGGTGCTACCTGTGTG
TGTGTAGATGAGTGTGCTGAAGGTGGGGAGGGCAGCACACAGCAGCTCATGGCAGAGCCG
CCTCCTAGGTCTTGGCAAAGAGGCAAGCTGACGATAGACATCTACCTATATTGTTAAGAA
AGGGGTCGGGGGGATCAGCCAAGGTCCATCATTGCTTTTTTGCCGCGCCCCCCCCCCCCC
GCCCCCATAGATTGTCAGCTGTAAGTGAAACTCCTAGTGAAAAAGAGGGGAGCCCTGTGT
TAGGAGTCCCCATAAACATGTACTGTAATTCTTTGTATATAGAAAAAAAATTTACTGTAA
AGTAAAGTTTAACTTTACTCATAAAAAAAAAAAAAAAA

Protein Sequence

>64324 : length: 2696
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNA
YGQDSPSCYIPLRRLQDLASMINVEYLNGSADGSESFQDPEKSDSRAQTPIVCTSLSPGG
PTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNYETKSENGVKVAMGSEQDSTPESRHGAVKSPFLPLAPQTETQKNKQ
RNEVDGSNEKAALLPAPFSLGDTNITIEEQLNSINLSFQDDPDSSTSTLGNMLELPGTSS
SSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRRP
YRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSK
WEASVGLAEQYDVPKGSKNRKCIPGSIKLDSEEDMPFEDCTNDPESEHDLLLNGCLKSLA
FDSEHSADEKEKPCAKSRARKSSDNPKRTSVKKGHIQFEAHKDERRGKIPENLGLNFISG
DISDTQASNELSRIANSLTGSNTAPGSFLFSSCGKNTAKKEFETSNGDSLLGLPEGALIS
KCSREKNKPQRSLVCGSKVKLCYIGAGDEEKRSDSISICTTSDDGSSDLDPIEHSSESDN
SVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAE
PGTETSQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHS
KSKQPKFRSIKCKHKENPVMAEPPVINEECSLKCCSSDTKGSPLASISKSGKVDGLKLLN
NMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHIP
IEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGRGDCSTNSPVGVSKVLVSGG
STHNSEKKGDGTQNSANPSPSGGDSALSGELSASLPGLLSDKRDLPASGKSRSDCVTRRN
CGRSKPSSKLRDAFSAQMVKNTVNRKALKTERKRKLNQLPSVTLDAVLQGDRERGGSLRG
GAEDPSKEDPLQIMGHLTSEDGDHFSDVHFDSKVKQSDPGKISEKGLSFENGKGPELDSV
MNSENDELNGVNQVVPKKRWQRLNQRRTKPRKRMNRFKEKENSECAFRVLLPSDPVQEGR
DEFPEHRTPSASILEEPLTEQNHADCLDSAGPRLNVCDKSSASIGDMEKEPGIPSLTPQA
ELPEPAVRSEKKRLRKPSKWLLEYTEEYDQIFAPKKKQKKVQEQVHKVSSRCEEESLLAR
GRSSAQNKQVDENSLISTKEEPPVLEREAPFLEGPLAQSELGGGHAELPQLTLSVPVAPE
VSPRPALESEELLVKTPGNYESKRQRKPTKKLLESNDLDPGFMPKKGDLGLSKKCYEAGH
LENGITESCATSYSKDFGGGTTKIFDKPRKRKRQRHAAAKMQCKKVKNDDSSKEIPGSEG
ELMPHRTATSPKETVEEGVEHDPGMPASKKMQGERGGGAALKENVCQNCEKLGELLLCEA
QCCGAFHLECLGLTEMPRGKFICNECRTGIHTCFVCKQSGEDVKRCLLPLCGKFYHEECV
QKYPPTVMQNKGFRCSLHICITCHAANPANVSASKGRLMRCVRCPVAYHANDFCLAAGSK
ILASNSIICPNHFTPRRGCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNIDIPE
GNWYCNDCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKMRHDVGEFPVLFFG
SNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKAQKELRQLQED
RKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDENPCGIDSECINRMLLYEC
HPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEE
CRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRV
GLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIATEEKSKKFK
KKQQGKRRTQGEITKEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKWECP
WHQCDICGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHDPCGPNPLEPGEIRE
YVPPPVPLPPGPSTHLAEQSTGMAAQAPKMSDKPPADTNQMLSLSKKALAGTCQRPLLPE
RPLERTDSRPQPLDKVRDLAGSGTKSQSLVSSQRPLDRPPAVAGPRPQLSDKPSPVTSPS
SSPSVRSQPLERPLGTADPRLDKSIGAASPRPQSLEKTSVPTGLRLPPPDRLLITSSPKP
QTSDRPTDKPHASLSQRLPPPEKVLSAVVQTLVAKEKALRPVDQNTQSKNRAALVMDLID
LTPRQKERAASPHQVTPQADEKMPVLESSSWPASKGLGHMPRAVEKGCVSDPLQTSGKAA
APSEDPWQAVKSLTQARLLSQPPAKAFLYEPTTQASGRASAGAEQTPGPLSQSPGLVKQA
KQMVGGQQLPALAAKSGQSFRSLGKAPASLPTEEKKLVTTEQSPWALGKASSRAGLWPIV
AGQTLAQSCWSAGSTQTLAQTCWSLGRGQDPKPEQNTLPALNQAPSSHKCAESEQK