ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6428

Name

SRSF3

Synonym

SFRS3|SRp20;serine/arginine-rich splicing factor 3;SRSF3;serine/arginine-rich splicing factor 3

Definition

pre-mRNA-splicing factor SRP20|splicing factor, arginine/serine-rich 3|splicing factor, arginine/serine-rich, 20-kD

Position

6p21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Transport of Mature mRNA derived from an Intron-Containing Transcript;PID Reactome;500928

Pathway

mRNA Splicing - Major Pathway;PID Reactome;500866

Pathway

mRNA Processing;Reactome;REACT:1675

Pathway

Spliceosome;KEGG PATHWAY;hsa03040

Pathway

Transcription;Reactome;REACT:1788

Pathway

Gene Expression;Reactome;REACT:71

Pathway

Post-Elongation Processing of the Transcript;Reactome;REACT:78

Pathway

mRNA 3'-end processing;PID Reactome;500105

Pathway

Cleavage of Growing Transcript in the Termination Region;PID Reactome;500570

External Links

Links to cell senescence gene database

6428

Links to epithelial mesenchymal transition gene database

6428

Links to ovarian cancer gene database

6428

Links to endometrial cancer gene database

6428

Links to iHOP

6428

Sequence Information

Nucleotide Sequence

>6428 : length: 3600
ATGTGATTCCAGTATGGCGTATAAATAAAGGCGAGGAGAAGGCGGTGGTCCGCCATTTCG
TGGACGCCGGGTGAGTGAGAGAGTTGGTTGGTGTTGGGCCGGAGGAAAGCGGGAAGACTC
ATCGGAGCGTGTGGATTTGAGCCGCCGCATTTTTTAACCCTAGATCTCGAAATGCATCGT
GATTCCTGTCCATTGGACTGTAAGGTTTATGTAGGCAATCTTGGAAACAATGGCAACAAG
ACGGAATTGGAACGGGCTTTTGGCTACTATGGACCACTCCGAAGTGTGTGGGTTGCTAGA
AACCCACCCGGCTTTGCTTTTGTTGAATTTGAAGATCCCCGAGATGCAGCTGATGCAGTC
CGAGAGCTAGATGGAAGAACACTATGTGGCTGCCGTGTAAGAGTGGAACTGTCGAATGGT
GAAAAAAGAAGTAGAAATCGTGGCCCACCTCCCTCTTGGGGTCGTCGCCCTCGAGATGAT
TATCGTAGGAGGAGTCCTCCACCTCGTCGCAGAGTCACCATCATGTCTCTTCTCACCACC
CTCTGAATCTGCATTAGCCAGTCAACTAGCCCTTTCAGCGTCATGTGACCAGCGCGCCCC
ATTCAGCTTGGCTGGTGTCGTTTCACATGACCCAGGCTGGCCAGTCGTCAGGTTGCACCG
CCCTTTGGTTCCCGAGCATGCTGTTTTCTCTCAGCCTTCTCTCCAACCTTAACCAAATCG
GCAGCAGCCACCTCGACCGCCCACACATTCCTGGCCAATCAGCTCAGCTGTTTATTTACC
AAATGTCTTCACAACAACTACAGCAGCAGCCTTCGGCTAACAAAAAAGCAGGAAAAATCC
ACAACACCCCCTTCGCCAACCAACTAAATCCAACGCAACATCTGGCAAAACCTTTTCAGC
AAATTCTTCCTGGCCGTCAGTCCGGCAGCCTCACCTCACCATTTCTAGCTTGTTGAAACC
CAAAACTAATCTCCAAGAAGGAGAAGCTTCTCTCGCAGCCGGAGCAGGTCCCTTTCTAGA
GATAGGAGAAGAGAGAGATCGCTGTCTCGGGAGAGAAATCACAAGCCGTCCCGATCCTTC
TCTAGGTCTCGTAGTCGATCTAGGTCAAATGAAAGGAAATAGAAGACAGTTTGCAAGAGA
AGTGGTGTACAGGAAATTACTTCATTTGACAGGAGTATGTACAGAAAATTCAAGTTTTGT
TTGAGACTTCATAAGCTTGGTGCATTTTTAAGATGTTTTAGCTGTTCAAATCTGTTTGTC
TCTTGAAACAGTGACACAAAGGTGTAATTCTCTATGGTTTGAAATGGATCATACGAGGCA
TGTAATACCAAGAATTGTTACTTTACAATGTTCCCTTAAGCAAAATTGAATTTGCTTTGA
ACTTTTAGTTATGCACAGACTGATAATAAACCTCTAAACCTGCCCAGCGGAAGTGTGTTT
TTTTTTAAATTTAAATACAGAAACAACTGGCAAAAATTGAACTAAGATTTACTTTTTTTT
CCATAGCTGGGATATAGGCTGCAGCTATAGTTGAACAAGCAGTCTTTAAAAACTGCTGTG
AAACACAGGCCATCAGGGAAAACGAAATGCTGCACTATTAAATTAGAGGTTTTTGAAAAA
TCCAACTCTCATCCTGGGCAGAGGTTGCCTAGTTGGTATAGAATGTTAAGTTTCAAGAAA
GTTTACCTTTGCTTTAGGTCATAAGTTCCTTATTTGATTGCTGTATATGGATACATGGCT
GTTCGTGACATTCTTTATGTGCAAATTTGTGATTTCAAAAATGTCCTGCCAGTTTAAGGG
TACATTGTAGAGCCGAACTTTGAGTTACTGTGCAAGATTTTTTTTTCATGCTGTCATTTG
TAATATGTTTTGTGAGAATCCTTGGGATTAAAGTTTTGGTTACAAATTGTTCTTTAACTT
GAAAGCCTGTTTTTCCTTGCAAACTCAAATCTGTGAGCTTGGTACCAAGTCCAGGTATAA
CATTCCTATTGGAAGCCATACTTATATTTTCTTGTAAAGTGCTTTTGAATTAATAAAATA
TTAGCATAATTGTGTATAGTCAGTTGAACCCACTGTTACCATTGTTCTTATCCCATGGGA
AGCAGTTGGTTACACGATTCTTATTTTATAAGAAACAGCTGAGAGGCACTATGGATTAGT
CTTCTGAAGTGAAGGAAATATAGATGTCACCTAAGTGATAGTTAACCCATTTTTTTTTTT
TTTAGGCATAGAAGCCAGTTCAGGGTCCATAATATTTAGTGACCAACATTTTAAAGTATA
GCAGCAACCTGGTTCTTAAACACAAAGTAAGTTGCCCATTAACAAATGGCTTTTATCTTT
AGCATGAAAACTTTCCACAGGTCTAAAAATTGCTTCCATTTTATAATTTGAGGTGTTGCA
TGGGAATTCTAAGCTGATCCATCATGATGTAAAAGTTCACAATATGGTTCAAATGTAACA
GTGCAGAATTGAATATGGAGGCATGCATAACCTTCCTCTTAGAAAATGGCAGGTGTTGTA
ATTTCAAATTTTTGTGCAATTAGATTAAATCATAATGCAACAGTCTTGTGGCTTAGTTTC
CTTAAATATGCTCTTAAGATAGTTTTGGATTATGCGGTATTGACTGTCTTAAATATGAAA
GATAAGTCATTGCATTAAGAGTTCAAGCTAAATGGATACATTAAGATACAGTTCCTAAAC
AAATTATTTATTTCCACCTTTTACACAAATCTTGGGAGAATTGGTGTCAGGAAGGTTCAG
CCTTAAAGTTAAGCATGTTCAAGAAAGACACTTTTCAGACAGCCTGTTTATTTACTGAGA
GCTCTGGCATTGGGCATTTTGTCTTTAGTATTCTCACATAGCCTACAACCTGTTCCTGTT
AGGAACAAGCCAAGATAGCTAAGAAGTTACGGAAGCCATGCAATATGTCAATTACATTGC
TTTTTATAAATGGACAACTTATGTGGGCATTTTTGGGCAGTATATGACTTCCTTGCAGGC
TCTTAAGTTGGAAGGGTTTCTGTAAAAAGGACAGTTACGGGTATAATATGGCTAAGAGAA
ATAATACAGAACCTGAAATAAAAGTAACTTCACCAGGGAGTTATCCTGACTTAGGTGACA
TACAGTCCCAGTTGGCAGTTACTTTAACCAGGAGCCCTAGCATAACCTCAAGACTCTTAG
AAACTTTAGAACATGGAAATTGTTAAAAGCTTTGAATTGCACATTTAGATTGTGGCTATT
AGGAATTTTTAAAGTTGTAATTCCTAAAATAACAGGTCACACTAACCGGTCTTGTCCATA
TTCAGGGTTGAGTGTAAAAATGAAAGGAATCACAAAACTGAACTTAGACCTGTGGTTTAA
GGATCAAGGTGTTCACTAGAAGTCACTGTTACTAATACTTGATGACAATGTAAAGAAACA
TTAAGGATTATATTTGATTGTTTTCAAAGACACTGGCTGGATGTGGTGGCTCACACTTGT
AATTCCTAGCACTTTGGGAGGCTAGGGCGGGTGGGAGGATCTCTTGAAGCCAGGAGTTGG
AGACCAGTCTGCCCAACATGGCAAGATTCACATTTCTATTAAAAGGAATATTTAGTTTGA

Protein Sequence

>6428 : length: 164
MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAA
DAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRS
FSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK