ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6427

Name

SRSF2

Synonym

PR264|SC-35|SC35|SFRS2|SFRS2A|SRp30b;serine/arginine-rich splicing factor 2;SRSF2;serine/arginine-rich splicing factor 2

Definition

SR splicing factor 2|splicing component, 35 kDa|splicing factor SC35|splicing factor, arginine/serine-rich 2

Position

17q25.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

mRNA Splicing;PID Reactome;500995

Pathway

mRNA Splicing - Major Pathway;PID Reactome;500866

Pathway

mRNA Processing;Reactome;REACT:1675

Pathway

mRNA Splicing - Minor Pathway;PID Reactome;500656

Pathway

Spliceosome;KEGG PATHWAY;hsa03040

Pathway

Transport of Mature mRNA derived from an Intron-Containing Transcript;PID Reactome;500928

Pathway

Transcription;Reactome;REACT:1788

Pathway

Gene Expression;Reactome;REACT:71

Pathway

Post-Elongation Processing of the Transcript;Reactome;REACT:78

Pathway

spliceosomal assembly;PID BioCarta;100033

Pathway

mRNA 3'-end processing;PID Reactome;500105

Pathway

Cleavage of Growing Transcript in the Termination Region;PID Reactome;500570

Disease

Leigh disease;FunDO

External Links

Links to cell senescence gene database

6427

Links to epithelial mesenchymal transition gene database

6427

Links to ovarian cancer gene database

6427

Links to endometrial cancer gene database

6427

Links to iHOP

6427

Sequence Information

Nucleotide Sequence

>6427 : length: 3003
AGAAGGTTTCATTTCCGGGTGGCGCGGGCGCCATTTTGTGAGGAGCGATATAAACGGGCG
CAGAGGCCGGCTGCCCGCCCAGTTGTTACTCAGGTGCGCTAGCCTGCGGAGCCCGTCCGT
GCTGTTCTGCGGCAAGGCCTTTCCCAGTGTCCCCACGCGGAAGGCAACTGCCTGAGAGGC
GCGGCGTCGCACCGCCCAGAGCTGAGGAAGCCGGCGCCAGTTCGCGGGGCTCCGGGCCGC
CACTCAGAGCTATGAGCTACGGCCGCCCCCCTCCCGATGTGGAGGGTATGACCTCCCTCA
AGGTGGACAACCTGACCTACCGCACCTCGCCCGACACGCTGAGGCGCGTCTTCGAGAAGT
ACGGGCGCGTCGGCGACGTGTACATCCCGCGGGACCGCTACACCAAGGAGTCCCGCGGCT
TCGCCTTCGTTCGCTTTCACGACAAGCGCGACGCTGAGGACGCTATGGATGCCATGGACG
GGGCCGTGCTGGACGGCCGCGAGCTGCGGGTGCAAATGGCGCGCTACGGCCGCCCCCCGG
ACTCACACCACAGCCGCCGGGGACCGCCACCCCGCAGGTACGGGGGCGGTGGCTACGGAC
GCCGGAGCCGCAGCCCTAGGCGGCGTCGCCGCAGCCGATCCCGGAGTCGGAGCCGTTCCA
GGTCTCGCAGCCGATCTCGCTACAGCCGCTCGAAGTCTCGGTCCCGCACTCGTTCTCGAT
CTCGGTCGACCTCCAAGTCCAGATCCGCACGAAGGTCCAAGTCCAAGTCCTCGTCGGTCT
CCAGATCTCGTTCGCGGTCCAGGTCCCGGTCTCGGTCCAGGAGTCCTCCCCCAGTGTCCA
AGAGGGAATCCAAATCCAGGTCGCGATCGAAGAGTCCCCCCAAGTCTCCTGAAGAGGAAG
GAGCGGTGTCCTCTTAAGAAAATGGTAATGTCTGGGAATCCGAGACACATAACCCTAATT
CATAAATGGGATTTGGGGTAGGTCTTTTTGAGTCGTGTTAATGTAAGAATGACTCCTATC
ATTAGGAGTGCTGCTCGGAGGTTACTCACCTTTGGGAGTAATACTGAAGAGAGGGGTCTG
CAGAAAGGATGTGTATGAAGCTTAGATAATAATGGCTGTTTCGTAAACTGTTTGAGACCT
ATTAATGAAAATGACTATTTCTTGCTGTTTTTATCCAACGTCTGCATTTTCCCCCTTTAA
AGCTGCGGTCTCCTGTTTGATAAAAGAATATTGGCCAGTATTGCAGATTTTAACTGATTT
GGCTGATCCTCCAGGGACCAGTTTCTGTGGGCGTGTATTGGAGCAGGTTTGTCTTTAAAT
GTTAAAGATGCACTATCCTCTTAGAGAAACAATCAGTTCAACTATTGTTGTACTGACTGG
GACTTCATATTCTAATGGATGTGGCAAAAGAATTGCAATAAGAAGCAGTGAACATTTGGA
ACCCCAAAAGAAAGTTACAGGTATTGCACTGGGTGGGGAAAGGATAGTGTGTCTTTAACT
CTTAAATTGTTTGGTCCTATTTTTTAAAAAGGAAAGGGCCCTAAGTAGCTCAGATATTAA
AGTAGTATTCTCAATTACCAAATGTTTCATTTGAAACAATTTATCTTAATGAAATATAGA
CCAATTCTCTGATCTCGAGTTGTTTTTGTTTGGATACAGCCCTTTTTTTTTTCTTTTTTT
TTCTTCCCCTTACCTTTCTTCACCTTGGTTATTTGGCCAGGAATACGTAAATTCAAACTT
GTACATGCTGATGGTAGCCTTTGTGAAATTTTCCTAATTGGGCCTTTTAAAAACATGGCT
GGGTGGAACATTTCTGTACCCTACTGGTTTGACCAGAGCCTTAGTAAGTACGTGCCTGAA
ACTGAAACCATGTGCACTTTAATGGAAGGTAAGCTGAACTTCTTTCTTTTCAAACCTAGA
TGTATCGGCAAGCAGTGTAAACGGAGGACTTGGGGAAAAAGGACCACATAGTCCATCGAA
GAAGAGTCCTTGGAACAAGCAACTGGCTATTGAAAAGGTTATTTTGTAACATTTGTCTAA
CTTTTTACTTGTTTAAGCTTTGCCTCAGTTGGCAAACTTCATTTTATGTGCCATTTTGTT
GCTGTTATTCAAATTTCTTGTAATTTAGTGAGGTGAACGACTTCAGATTTCATTATTGGA
TTTGGATATTTGAGGTAAAATTTCATTTTGTTATATAGTGCTGACTTTTTTTGTTTGAAA
TTAAACAGATTGGTAACCTAATTTGTGGCCTCCTGACTTTTAAGGAAAACGTGTGCAGCC
ATTACACACAGCCTAAAGCTGTCAAGAGATTGACTCGGCATTGCCTTCATTCCTTAAAAT
TAAAAACCTACAAAAGTTGGTGTAAATTTGTATATGTTATTTACCTTCAGATCTAAATGG
TAATCTGAACCCAAATTTGTATAAAGACTTTTCAGGTGAAAAGACTTGATTTTTTGAAAG
GATTGTTTATCAAACACAATTCTAATCTCTTCTCTTATGTATTTTTGTGCACTAGGCGCA
GTTGTGTAGCAGTTGAGTAATGCTGGTTAGCTGTTAAGGTGGCGTGTTGCAGTGCAGAGT
GCTTGGCTGTTTCCTGTTTTCTCCCGATTGCTCCTGTGTAAAGATGCCTTGTCGTGCAGA
AACAAATGGCTGTCCAGTTTATTAAAATGCCTGACAACTGCACTTCCAGTCACCCGGGCC
TTGCATATAAATAACGGAGCATACAGTGAGCACATCTAGCTGATGATAAATACACCTTTT
TTTCCCTCTTCCCCCTAAAAATGGTAAATCTGATCATATCTACATGTATGAACTTAACAT
GGAAAATGTTAAGGAAGCAAATGGTTGTAACTTTGTAAGTACTTATAACATGGTGTATCT
TTTTGCTTATGAATATTCTGTATTATAACCATTGTTTCTGTAGTTTAATTAAAACATTTT
CTTGGTGTTAGCTTTTCTCAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

Protein Sequence

>6427 : length: 221
MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFV
RFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSR
SPRRRRRSRSRSRSRSRSRSRSRYSRSKSRSRTRSRSRSTSKSRSARRSKSKSSSVSRSR
SRSRSRSRSRSPPPVSKRESKSRSRSKSPPKSPEEEGAVSS