ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6426

Name

SRSF1

Synonym

ASF|SF2|SF2p33|SFRS1|SRp30a;serine/arginine-rich splicing factor 1;SRSF1;serine/arginine-rich splicing factor 1

Definition

SR splicing factor 1|alternative-splicing factor 1|pre-mRNA-splicing factor SF2, P33 subunit|splicing factor 2|splicing factor, arginine/serine-rich, 30-KD, A

Position

17q22

Gene Type

protein-coding

Pathways and Diseases

Pathway

mRNA Splicing;PID Reactome;500995

Pathway

mRNA Splicing - Major Pathway;PID Reactome;500866

Pathway

mRNA Processing;Reactome;REACT:1675

Pathway

mRNA Splicing - Minor Pathway;PID Reactome;500656

Pathway

Spliceosome;KEGG PATHWAY;hsa03040

Pathway

Transport of Mature mRNA derived from an Intron-Containing Transcript;PID Reactome;500928

Pathway

Transcription;Reactome;REACT:1788

Pathway

Gene Expression;Reactome;REACT:71

Pathway

Post-Elongation Processing of the Transcript;Reactome;REACT:78

Pathway

mRNA 3'-end processing;PID Reactome;500105

Pathway

Cleavage of Growing Transcript in the Termination Region;PID Reactome;500570

Disease

Eye disease;FunDO

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

6426

Links to epithelial mesenchymal transition gene database

6426

Links to ovarian cancer gene database

6426

Links to endometrial cancer gene database

6426

Links to iHOP

6426

Sequence Information

Nucleotide Sequence

>6426 : length: 5668
GTTGCGCTCCCGCGCGTGCGTGTTGGGATCGAATCGCTGTTTCCTTCCGCTTCTCTTCCT
CTGTCTCCCCCCCATATCCGTGCGCCGAGCTGATAAAGGCGCCATTTTGGAGGGGCCGCG
GGAGACGTGGTGCCGCTGCGGGCTCGCTCTGCCGTGCGCTAGGCTTGGTGGGAAGGCCTG
TTCTCGAGTCCGCGCTTTTCGTCACCGCCATGTCGGGAGGTGGTGTGATTCGTGGCCCCG
CAGGGAACAACGATTGCCGCATCTACGTGGGTAACTTACCTCCAGACATCCGAACCAAGG
ACATTGAGGACGTGTTCTACAAATACGGCGCTATCCGCGACATCGACCTCAAGAATCGCC
GCGGGGGACCGCCCTTCGCCTTCGTTGAGTTCGAGGACCCGCGAGACGCGGAAGACGCGG
TGTATGGTCGCGACGGCTATGATTACGATGGGTACCGTCTGCGGGTGGAGTTTCCTCGAA
GCGGCCGTGGAACAGGCCGAGGCGGCGGCGGGGGTGGAGGTGGCGGAGCTCCCCGAGGTC
GCTATGGCCCCCCATCCAGGCGGTCTGAAAACAGAGTGGTTGTCTCTGGACTGCCTCCAA
GTGGAAGTTGGCAGGATTTAAAGGATCACATGCGTGAAGCAGGTGATGTATGTTATGCTG
ATGTTTACCGAGATGGCACTGGTGTCGTGGAGTTTGTACGGAAAGAAGATATGACCTATG
CAGTTCGAAAACTGGATAACACTAAGTTTAGATCTCATGAGGTAGGTTATACACGTATTC
TTTTCTTTGACCAGAATTGGATACAGTGGTCTTAACAGTGGAATTTCAAGGTAAGGATTC
AGGCAAGGTTGTCCAAGTAAATTGCCAGATTTCTGGTTTTAGTTACATTGTATTCATTCA
GCATGTCTGAAGATAGATGAAAGCTTAGATCTTTCAATGGAAAGTTCTGTCTATCCAATA
GGGAGAAACTGCCTACATCCGGGTTAAAGTTGATGGGCCCAGAAGTCCAAGTTATGGAAG
ATCTCGATCTCGAAGCCGTAGTCGTAGCAGAAGCCGTAGCAGAAGCAACAGCAGGAGTCG
CAGTTACTCCCCAAGGAGAAGCAGAGGATCACCACGCTATTCTCCCCGTCATAGCAGATC
TCGCTCTCGTACATAAGATGATTGGTGACACTTTTTGTAGAACCCATGTTGTATACAGTT
TTCCTTTATTCAGTACAATCTTTTCATTTTTTAATTCAAACTGTTTTGTTCAGAATGGGC
TAAAGTGTTGAATTGCATTCTTGTAATATCCCCTTGCTCCTAACATCTACATTCCCTTCG
TGTCTTTGATAAATTGTATTTTAAGTGATGTCATAGACAGGATTGTTTAAATTTAGTTAA
CTCCATACTCTTCAGACTGTGATATTGTGTAAATGTCTATCTGCCCTGGTTTGTGTGAAC
TGGGATGTTGGGGGTGTTTGTGGTTATCTTACCTGGGGAAGTTCTTATGTTTATCTTGCT
TTTCATGTGTCTTTCTGTAGACATATCTGAAGAGATGGATTAAGAATGCTTTGGATTAAG
GATTGTGGAGCACATTTCAATCATTTTAGGATTGTCAAAAGGAGGATTGAGGAGGATCAG
ATCAATAATGGAGGCAATGGTATGACTCCAAGTGCTATTGTCACAGATGAAATTGGCAGT
ATTGACCTTATACTAAAAGGCAGGGGTTAAAAATGATTATATACATTTTCCTTAAAACAC
TTGCAAACATTTTATTCAGTTGTCTTTAGCTACAATTGCTTTGCTTTTTAAACCTTGGCA
ATTGTGGCAAAATTATATTGCCCATTTTGTAGCAACTTATTTTGCTCCCTTCCCCCCATT
TTTGTTTTAATAGGGACTAATGTGGGAAGAACTGGCTAATTTGTCACAGTGCTTAGTTAC
AACTGTTAATGTGTGACCTGCTGTTGGTGTACATGTGGGTACAGGGTGTTTTTAAATCCA
ACAAGATAGAGTATAATATCAATACTGCTAAATCTGCATGTCCTCTGTGTGACTGATAGA
GCGTTGCTATTTCATTTTTTTAAGACAAAATGAAAGCAAAATATAGAGTTCCAATGTATT
GGTGTAGATAATCTAGTTGGGAATACTTTTAAGTCTCACCTTCCCCTTTAAACTAATATT
CATAATTGGTTCATATGTTTAAAAGACTTTAATTTACAAATTAAATTGCAAATGGGAGCA
TTAGATTTAGTTTTAGACTTAGGTGGGTAGCAATGCCAGTAAACTTAAATTACGTAACTT
CTTGCAACCACGAAACCTGTAATACGCTGTACAGTAACAAGTGTTGGCATTATCAGTTGA
ACTGTAAATACAAAATGCTTCTTCCAATTAGTCTCTATGATGATTAAGTTTCTAAAATTT
ATCTGAACACCATTCAGAAACTTGTTTTGGGGAATTTGATAGTTATTGATGTGCATCTGT
TAAACTGATGACAGACATAACTCATCATTCCCCAGAAACCTTTTTTGATTACAGTATCTA
ACATTTTGCCTCCTCTTTTTTGGTTTTGCTGGTTATAAAGGTTTGGATTGGAGAGGGCTC
ACTGGATCCCAATCCTTGGAGCTGGATCATTGGATTCAAATCATAATGTGGATAGGATAG
GGAGGATGAATTACCAGGATTCATGGAGCGGGATCAGATTACCAGGAACATAGGAGTGGA
TTCCTGCCCCAACCAAACCGCATTCGTGTGGATTTTTTTATTCAACTTAATTGGCTATTC
CAAAGATTTTTTTTTTCCTATTTTTGACGATTGGAGCCCTTAAGATGCACGATGGAATTG
TGTTTTGCGTTTTTTGGTAAAAGGAGCAAAGCGAGGACCTGGAGATAAACGCTGGAGCAA
TCTCCTTGGAAGGATTCAGCACGAGTAGATGGTAAACATTTAAAGGGGAAAGGGGGGGTT
TGTTTAAAATAGTAAATCAGTAAGTCACTTCTAAATTTAAAGAAAACAAAATTGGAGTTG
AAGAATAAGTAGGTTTCCAATTGGCTATTGCCGTTTTCTTTGAAAAAATAAACATTTTTT
AAAAAACTATGCATGGTTGTCCTTTTTCCTCTTCATGTAAGATTCTAACTGGGTCTATCA
GTTAATCTTTAAATTGTTAAGTAAGATAAGATTTTGACTCTTGTGTTAATGTGTTAGCAA
ATTAAAAGTTCTTAAAAGGCAATCTAATGGTATTAGCCATCTTTTATTGTTAATTGTAAA
AGTCTTCAGGGGAAAGCAAAAGGGGAGAATAAGGCATTTGTGTATGTAACTTGGTAAATG
ACGGTGGGGGATGGATCTAGCATCTGAAAGATAAGCTTCTCTACTTTGTTATAAAGTGGT
TAAAAAACTATAGATGCTGCTTATTTTCTGGTGGTCATAGACAACATAGGCTTTTGTGCA
AAATTGGTTGATGGCTACTAATGTTCACTTGGAGATAGCTTTTGATATTCTCAATGAAAC
TCATCTCAAAAAAAGGTAAGTATTAAATGTTAACATCAGCACAGATGTATTAGAACTGTT
TTTTGTTTTTGAGACAGAGTCTCGCTCTGTTCTCCAGACTGGAGGGCAGTGGTGTGATCT
AGGCTCACTGCAACCTCCACCCCTGGATTTGAGTGATTCTCGTGCCTCAGTCTCCCAAGT
AGCTGAGACTACAAGTGTGTGCCACCCTTGCCCGGCTAATTTTGTATTTTTAGTAGAGAT
GTGGTTTCTCTGTGTTACCCAGGCTGGTCCCAAAACTCCTGGCCTCAAGTGATCTGCCTG
CCTTGGCCTCCCAAAGTGTTAGGATTACAGGTGTGAGCCACCATGCTCAGCCTGTAGAAC
TTTTAACCCAAGTCTCATTTCTTTTTTGAAAGGGAAGAGTGCACAAGATTAACTGCTTCT
TTGGATGAATCATTGTTAATAAAAAGCTGGGCATTTAGAATTTTGCCTTATAAGCCCTTC
TCCAACCATAAGATTATTTTGTACCAAAAACTTTGGTGTTCTCTACCAAAGCAGTTAAAA
ACTTTTAGCCTGCTACTTCTTGTATTTGTCTACTGACAGCCCCTTGGTACTATTTAGGTT
GGGGGAGGGGACCTAAAATAAATAGACTTTAACATTTCCCTTGGGTGCTAATCATAGTTG
GAAGTTGAATTTAAGGTGATTATTTGGGTGACAATTAAAAACCTAAGGAAAACCAGAAAT
CTTGGTAGTGGAAGAAATGTGTAAGGTCACCCCAATCGGTAGATTTTAATGAACGTTGTG
GAATGTTGGGAAGAGGGGATGTTAAGTTGAATGCAGAATTTCACTAAGTACTTAGTGTAA
GTTTAAGGATGTAGCTCTTTTTATCTAAGAATTCAATGTAATGGCCAAAAGGCAGATTTA
CTGTTTAAAAATTTGAATAATTTTACATGACATTCTTGAAATTCTAAGAAGTTTTATGTG
TAGAACATTTTAAAAATTCATCAGATTATTAAAGGGAAAATAAATGATTAATGATAATTT
TGGAAGGTTAATGTGAGCTAGACTTAAGTAAACTTTGGTTCATTTGTGTTCATTGAATGT
TTTGGAAATGACCAAAAAATGTAAATGGCCTTCACTCAAGTTTGAGTGTTTAAAGTTGAA
AGATGTGCTCTACTAAAAGTTATAGTAATTCTAACCTCACATTGAAATGAGACAGTATTC
CTTGTTATACAGGCTGAATTTGAAGATTAGAGAGGATCTAATGTTTACTTAGGTAAAGGG
GCATAGGTTTTGTAGTTAAGATGACCAGACAGCTAAAAGCTGTGATGGGAAGTATGGACT
GCTCCTATTTATAGTCTCAGAAAATGGACCTTTAGGTCTCTATCCGTATTGGCAATTATT
AGAAGAAAGTTACACCCTTTTGAAACTACAAAAGCTGTCTTGGAATTTCCCCCTCTTCTC
CCTATTTATGTCCCCTTAGAATATTTTAGGGAGCCTATAATTATTTTCTAACCAAGGAAA
AACTTAAGTCTCTTTAAGAAGCAATTACTTTTCATAACATCAGATTGAATAACCCACCTT
GCTGTTCAGCCCACATCCTACTGGAAACAAAAGGTAAGAAACCCATTTTCTGGTTCTTGA
TTGTTTGGGTCTGAATTTTGTTTTTAAAACTAAGCTAAGTTTAATGTTTTTTAAAATGCT
GTTTGGAATATGAATAGATTCCCCGTAAAATGATTTTTCCTAAGTTTTATGCTTTAGTAA
ATATTCAGTGCTCACGTCTGTGCATCATAGTGCTTGCGTTTAATATGATTTATTGTAGAA
TCTCAACTTTTCTTGGTGTTTGTTGTCTTTGAAACATTGTCTTGGTCATTAGGGCTGGTG
TTTTCACATTTCTGTGGTCAAGGTGGATTTCTTATGTGTGCCTTTTTGCTTACTTTGTAT
ATGAATTTTGTAATTTAAATTGCAAGTAAGTTATATATATGTATTTACCATAAATAGTAT
TAAAAGATGAGAAACTGTTAGACTGAAGTTCTGTTGTAACATAACCATTATTTCCATCAC
AGTATGAAGACTGCAAACGCAGAAAACAGATTACAGTCTCTTATCCATTTTTTGAAATCC
AAAAACTACGAAAACAAAAGATTTTCTGTTGTTGAGCTAATTAAATGTGAACCCTGACCA
GAAAAAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>6426 : length: 248
MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVE
FEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSE
NRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKF
RSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPR
HSRSRSRT