ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

64220

Name

STRA6

Synonym

MCOPCB8|MCOPS9|PP14296;stimulated by retinoic acid 6;STRA6;stimulated by retinoic acid 6

Definition

retinol binding protein 4 receptor|stimulated by retinoic acid 6 homolog|stimulated by retinoic acid gene 6 homolog|stimulated by retinoic acid gene 6 protein homolog

Position

15q24.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

64220

Links to epithelial mesenchymal transition gene database

64220

Links to ovarian cancer gene database

64220

Links to endometrial cancer gene database

64220

Links to iHOP

64220

Sequence Information

Nucleotide Sequence

>64220 : length: 3097
GTATTTCCATCACCGAGGCCCAAAGGGGCCAGAAAGGGGCAGGCTGAGGCTGGGGGAGGG
GCTCAAGGGAGCCCAGCTGGGAGGGCCCAGGCAGGCAGTGCGGAGCTGGCCGTGGGCTGC
CTACCCTTTCATCTCTGCAACTCCTTCCTCCCTGGGCCTCCCTTCTGGTGTGTCTGTGGG
TCTGTCTAGGTGGGCTTGGGAAAGGGGAAGGAAGGGGCGTCTCTTTAGGCAGCTCAGACT
GGACAAGCCTTCTTTGAAAATGGTCCTTTGAACACACGCCTGCTGGTGGTTGGTCAGACA
GATGCGCCAGCGGGAGCCCCGGGGCCCCAAGGGGACAGCTATCTCTGCAGGACCAGTGCG
ATGGGCGGGAAGGGAGGAGGGGACACGAGAGGCCCTGTCCTCTTCCCGTGCCAGCTTGCT
CAGGCCCTCAGTCCCAGACGGGCTTTTCCCAGAGAGCTAAAAGAGAAGGGCCAGAGAATG
TCGTCCCAGCCAGCAGGGAACCAGACCTCCCCCGGGGCCACAGAGGACTACTCCTATGGC
AGCTGGTACATCGATGAGCCCCAGGGGGGCGAGGAGCTCCAGCCAGAGGGGGAAGTGCCC
TCCTGCCACACCAGCATACCACCCGGCCTGTACCACGCCTGCCTGGCCTCGCTGTCAATC
CTTGTGCTGCTGCTCCTGGCCATGCTGGTGAGGCGCCGCCAGCTCTGGCCTGACTGTGTG
CGTGGCAGGCCCGGCCTGCCCAGCCCTGTGGATTTCTTGGCTGGGGACAGGCCCCGGGCA
GTGCCTGCTGCTGTTTTCATGGTCCTCCTGAGCTCCCTGTGTTTGCTGCTCCCCGACGAG
GACGCATTGCCCTTCCTGACTCTCGCCTCAGCACCCAGCCAAGATGGGAAAACTGAGGCT
CCAAGAGGGGCCTGGAAGATACTGGGACTGTTCTATTATGCTGCCCTCTACTACCCTCTG
GCTGCCTGTGCCACGGCTGGCCACACAGCTGCACACCTGCTCGGCAGCACGCTGTCCTGG
GCCCACCTTGGGGTCCAGGTCTGGCAGAGGGCAGAGTGTCCCCAGGTGCCCAAGATCTAC
AAGTACTACTCCCTGCTGGCCTCCCTGCCTCTCCTGCTGGGCCTCGGATTCCTGAGCCTT
TGGTACCCTGTGCAGCTGGTGAGAAGCTTCAGCCGTAGGACAGGAGCAGGCTCCAAGGGG
CTGCAGAGCAGCTACTCTGAGGAATATCTGAGGAACCTCCTTTGCAGGAAGAAGCTGGGA
AGCAGCTACCACACCTCCAAGCATGGCTTCCTGTCCTGGGCCCGCGTCTGCTTGAGACAC
TGCATCTACACTCCACAGCCAGGATTCCATCTCCCGCTGAAGCTGGTGCTTTCAGCTACA
CTGACAGGGACGGCCATTTACCAGGTGGCCCTGCTGCTGCTGGTGGGCGTGGTACCCACT
ATCCAGAAGGTGAGGGCAGGGGTCACCACGGATGTCTCCTACCTGCTGGCCGGCTTTGGA
ATCGTGCTCTCCGAGGACAAGCAGGAGGTGGTGGAGCTGGTGAAGCACCATCTGTGGGCT
CTGGAAGTGTGCTACATCTCAGCCTTGGTCTTGTCCTGCTTACTCACCTTCCTGGTCCTG
ATGCGCTCACTGGTGACACACAGGACCAACCTTCGAGCTCTGCACCGAGGAGCTGCCCTG
GACTTGAGTCCCTTGCATCGGAGTCCCCATCCCTCCCGCCAAGCCATATTCTGTTGGATG
AGCTTCAGTGCCTACCAGACAGCCTTTATCTGCCTTGGGCTCCTGGTGCAGCAGATCATC
TTCTTCCTGGGAACCACGGCCCTGGCCTTCCTGGTGCTCATGCCTGTGCTCCATGGCAGG
AACCTCCTGCTCTTCCGTTCCCTGGAGTCCTCGTGGCCCTTCTGGCTGACTTTGGCCCTG
GCTGTGATCCTGCAGAACATGGCAGCCCATTGGGTCTTCCTGGAGACTCATGATGGACAC
CCACAGCTGACCAACCGGCGAGTGCTCTATGCAGCCACCTTTCTTCTCTTCCCCCTCAAT
GTGCTGGTGGGTGCCATGGTGGCCACCTGGCGAGTGCTCCTCTCTGCCCTCTACAACGCC
ATCCACCTTGGCCAGATGGACCTCAGCCTGCTGCCACCGAGAGCCGCCACTCTCGACCCC
GGCTACTACACGTACCGAAACTTCTTGAAGATTGAAGTCAGCCAGTCGCATCCAGCCATG
ACAGCCTTCTGCTCCCTGCTCCTGCAAGCGCAGAGCCTCCTACCCAGGACCATGGCAGCC
CCCCAGGACAGCCTCAGACCAGGGGAGGAAGACGAAGGGATGCAGCTGCTACAGACAAAG
GACTCCATGGCCAAGGGAGCTAGGCCCGGGGCCAGCCGCGGCAGGGCTCGCTGGGGTCTG
GCCTACACGCTGCTGCACAACCCAACCCTGCAGGTCTTCCGCAAGACGGCCCTGTTGGGT
GCCAATGGTGCCCAGCCCTGAGGGCAGGGAAGGTCAACCCACCTGCCCATCTGTGCTGAG
GCATGTTCCTGCCTACCATCCTCCTCCCTCCCCGGCTCTCCTCCCAGCATCACACCAGCC
ATGCAGCCAGCAGGTCCTCCGGATCACTGTGGTTGGGTGGAGGTCTGTCTGCACTGGGAG
CCTCAGGAGGGCTCTGCTCCACCCACTTGGCTATGGGAGAGCCAGCAGGGGTTCTGGAGA
AAGAAACTGGTGGGTTAGGGCCTTGGTCCAGGAGCCAGTTGAGCCAGGGCAGCCACATCC
AGGCGTCTCCCTACCCTGGCTCTGCCATCAGCCTTGAAGGGCCTCGATGAAGCCTTCTCT
GGAACCACTCCAGCCCAGCTCCACCTCAGCCTTGGCCTTCACGCTGTGGAAGCAGCCAAG
GCACTTCCTCACCCCCTCAGCGCCACGGACCTCTCTGGGGAGTGGCCGGAAAGCTCCCGG
GCCTCTGGCCTGCAGGGCAGCCCAAGTCATGACTCAGACCAGGTCCCACACTGAGCTGCC
CACACTCGAGAGCCAGATATTTTTGTAGTTTTTATGCCTTTGGCTATTATGAAAGAGGTT
AGTGTGTTCCCTGCAATAAACTTGTTCCTGAGAAAAA

Protein Sequence

>64220 : length: 706
MGGKGGGDTRGPVLFPCQLAQALSPRRAFPRELKEKGQRMSSQPAGNQTSPGATEDYSYG
SWYIDEPQGGEELQPEGEVPSCHTSIPPGLYHACLASLSILVLLLLAMLVRRRQLWPDCV
RGRPGLPSPVDFLAGDRPRAVPAAVFMVLLSSLCLLLPDEDALPFLTLASAPSQDGKTEA
PRGAWKILGLFYYAALYYPLAACATAGHTAAHLLGSTLSWAHLGVQVWQRAECPQVPKIY
KYYSLLASLPLLLGLGFLSLWYPVQLVRSFSRRTGAGSKGLQSSYSEEYLRNLLCRKKLG
SSYHTSKHGFLSWARVCLRHCIYTPQPGFHLPLKLVLSATLTGTAIYQVALLLLVGVVPT
IQKVRAGVTTDVSYLLAGFGIVLSEDKQEVVELVKHHLWALEVCYISALVLSCLLTFLVL
MRSLVTHRTNLRALHRGAALDLSPLHRSPHPSRQAIFCWMSFSAYQTAFICLGLLVQQII
FFLGTTALAFLVLMPVLHGRNLLLFRSLESSWPFWLTLALAVILQNMAAHWVFLETHDGH
PQLTNRRVLYAATFLLFPLNVLVGAMVATWRVLLSALYNAIHLGQMDLSLLPPRAATLDP
GYYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTK
DSMAKGARPGASRGRARWGLAYTLLHNPTLQVFRKTALLGANGAQP