ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6418

Name

SET

Synonym

2PP2A|I2PP2A|IGAAD|IPP2A2|PHAPII|TAF-I|TAF-IBETA;SET nuclear proto-oncogene;SET;SET nuclear proto-oncogene

Definition

HLA-DR-associated protein II|SET nuclear oncogene|SET translocation (myeloid leukemia-associated)|Template-Activating Factor-I, chromatin remodelling factor|inhibitor of granzyme A-activated DNase|inhibitor-2 of protein phosphatase-2A|phosphatase 2A inhib

Position

9q34

Gene Type

protein-coding

Pathways and Diseases

Pathway

granzyme a mediated apoptosis pathway;PID BioCarta;100035

Disease

Leukemia;FunDO

Disease

Carcinoma;FunDO

Disease

Ovary cancer;FunDO

Disease

Prostate cancer;FunDO

External Links

Links to cell senescence gene database

6418

Links to epithelial mesenchymal transition gene database

6418

Links to ovarian cancer gene database

6418

Links to endometrial cancer gene database

6418

Links to iHOP

6418

Sequence Information

Nucleotide Sequence

>6418 : length: 2936
GTAGGAGGAGGTGGAGGAGGAGGCGGCTCGGGAGAGCGAGCAGCGAGCTGGCTGGATCGC
CGAGCGCGAGTGAGGGAGCCGAGCCGCCCGCCGCCGCCGCCTCCGCCTCCCCTCCGCGAA
CAGGAGCCCGGGCCGGGGCCCGGCACGCCGCCCCAGCCCGTCCCTCGGCGTCAGGCCGCG
AGGGTAGCGCGCGCGAGCGAGCGAGGGGGAGGGAGAGCGAGCGAGCGCCGGGAGGAGGCG
GCCGGACCGAGCGGGCGCCCGCGCGTGTGGCGTGAGGGGAAGCCGCTTGCCCGCCCCCTT
CGCCTTCCCTTCTCTCCCCCTCCCCGCTCCCCCCCCGACCGCGGAGCAGCACCATGTCGG
CGCCGGCGGCCAAAGTCAGTAAAAAGGAGCTCAACTCCAACCACGACGGGGCCGACGAGA
CCTCAGAAAAAGAACAGCAAGAAGCGATTGAACACATTGATGAAGTACAAAATGAAATAG
ACAGACTTAATGAACAAGCCAGTGAGGAGATTTTGAAAGTAGAACAGAAATATAACAAAC
TCCGCCAACCATTTTTTCAGAAGAGGTCAGAATTGATCGCCAAAATCCCAAATTTTTGGG
TAACAACATTTGTCAACCATCCACAAGTGTCTGCACTGCTTGGGGAGGAAGATGAAGAGG
CACTGCATTATTTGACCAGAGTTGAAGTGACAGAATTTGAAGATATTAAATCAGGTTACA
GAATAGATTTTTATTTTGATGAAAATCCTTACTTTGAAAATAAAGTTCTCTCCAAAGAAT
TTCATCTGAATGAGAGTGGTGATCCATCTTCGAAGTCCACCGAAATCAAATGGAAATCTG
GAAAGGATTTGACGAAACGTTCGAGTCAAACGCAGAATAAAGCCAGCAGGAAGAGGCAGC
ATGAGGAACCAGAGAGCTTCTTTACCTGGTTTACTGACCATTCTGATGCAGGTGCTGATG
AGTTAGGAGAGGTCATCAAAGATGATATTTGGCCAAACCCATTACAGTACTACTTGGTTC
CCGATATGGATGATGAAGAAGGAGAAGGAGAAGAAGATGATGATGATGATGAAGAGGAGG
AAGGATTAGAAGATATTGACGAAGAAGGGGATGAGGATGAAGGTGAAGAAGATGAAGATG
ATGATGAAGGGGAGGAAGGAGAGGAGGATGAAGGAGAAGATGACTAAATAGAACACTGAT
GGATTCCAACCTTCCTTTTTTTAAATTTTCTCCAGTCCCTGGGAGCAAGTTGCAGTCTTT
TTTTTTTTTTTTTTTTTTTTTCCCTCTTGTGCTCAGTCGCCCTGTTCTTGAGGTCTCTTT
TCTCTACTCCATGGTTCTCAATTTATTTGGGGGGAAATACCTTGAGCAGAATACAATGGG
AAAAGAGTCTCTACCCCTTTCTGTTCGAAGTTCATTTTTATCCCTTCCTGTCTGAACAAA
AACTGTATGGAATCAACACCACCGAGCTCTGTGGGAAAAAAGAAAAACCTGCTCCCTTCG
CTCTGCTGGAAGCTGGAGGGTGCTAGGCCCCTGTGTAGTAGTGCATAGAATTCTAGCTTT
TTTCCTCCTTTCTCTGTATATTGGGCTCAGAGAGTACACTGTGTCTCTATGTGAATATGG
ACAGTTAGCATTTACCAACATGTATCTGTCTACTTTCTCTTGTTTAAAAAAAGAAAAAAA
AACTTAAAAAAATGGGGTTATAGAAGGTCAGCAAAGGGTGGGTTTGAGATGTTTGGGTGG
GTTAAGTGGGCATTTTGACAACATGGCTTCTCCTTTGGCATGTTTAATTGTGATATTTGA
CAGACATCCTTGCAGTTTAAGATGACACTTTTAAAATAAATTCTCTCCTAATGATGACTT
GAGCCCTGCCACTCAATGGGAGAATCAGCAGAACCTGTAGGATCTTATTTGGAATTGACA
TTCTCTATTGTAATTTTGTTCCTGTTTATTTTTAAATTTTCTTTTTGTTTCACTGGAAAG
GAAAGATGATGCTCAGTTTTAAACGTTAAAAGTGTACAAGTTGCTTTGTTACAATAAAAC
TAAATGTGTACACAAAGGATTTGATGCTTTTCTCTCAGCATAGGTATGCTTACTATGACC
TTCCAAGTTTGACTTGTATAACATCACTGTCAAACTTTGTCACCCTAACTTCGTATTTTT
TGATACGCACTTTGCAGGATGACCTCAGGGCTATGTGGATTGAGTAATGGGATTTGAATC
AATGTATTAATATCTCCATAGCTGGGAAACGTGGGTTCAATTTGCCATTGGTTTCTGAAA
GTATTCACATCATTTGGGATACCAGATAGCTCAATACTCTCTGAGTACATTGTGCCCTTG
ATTTTTATCTCCAAGTGGCAGTTTTTAAAATTGGCCTTTTACCTGGATATAAATTAATTG
TGCCTGCCACCACCATCCAACAGACCTGGTGCTCTAATGCCAAGTTATACACGGGACAGT
TGCTGGCATGTCTTCATTGGCTATATAAAATGTGGCCAAGAAGATAGGCTCTCAGTAAGA
AGTCTGATGGTGAGCAGTAACTGTCCCTGCTTTCTGGTATAAAGCTCTCAAATGTGACCA
TGTGAATCTGGGTGGGATAATGGACTCAGCTCTGTCTGCTCAATGCCATTGTGCAGAGAA
GCACCCTAATGCATAAGCTTTTTAATGCTGTAAAATATAGTCGCTGAAATTAAATGCCAC
TTTTTCAGAGGTGAATTAATGGACAGTCTGGTGAACTTCAAAAGCTTTTTGATGTATAAA
ACTTGATAAATGGAACTATTCCATCAATAGGCAAAAGTGTAACAACCTATCTAGATGGAT
AGTATGTAATTTCTGCACAGGTCTCTGTTTAGTAAATACATCACTGTATACCGATCAGGA
ATCTTGCTCCAATAAAGGAACATAAAGATTTTTTTTGGAAAAAAAAAAAAAAAAAA

Protein Sequence

>6418 : length: 290
MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNE
QASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYL
TRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLT
KRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDD
EEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD