ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

64083

Name

GOLPH3

Synonym

GOPP1|GPP34|MIDAS|Vps74;golgi phosphoprotein 3 (coat-protein);GOLPH3;golgi phosphoprotein 3 (coat-protein)

Definition

Golgi phosphoprotein 3|coat protein GPP34|coat-protein|golgi peripheral membrane protein 1, 34 kDa|golgi protein|golgi-associated protein|mitochondrial DNA absence factor

Position

5p13.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

64083

Links to epithelial mesenchymal transition gene database

64083

Links to ovarian cancer gene database

64083

Links to endometrial cancer gene database

64083

Links to iHOP

64083

Sequence Information

Nucleotide Sequence

>64083 : length: 2676
ATATTGGAAAGGCGCCGCCGCCGCCTCCGCCTTGGAGCTCGGGGTGTTTCGGGGACTGCG
GCCACAGGCAGGAAGGCGCTCCTCTCCTGCCCCGCCGACGCCCGGCCAGCCCGCTTCGCC
CTGACCTGTTTCCTCATGACTGCCCCCGGCCCTGCTGCCGACGGACGTCGCCCCGGCGTC
CGGATTTAACACGGAAACCCGGATCGGAGGCCGCGCGGGGAGGAGGAGGGCGACCCGGTC
GGTCCTGCGACCCTCTCGGCCCGGCTCGGCGCCTCGGCGGGAGCCATGACCTCGCTGACC
CAGCGCAGCTCCGGCCTGGTGCAGCGGCGCACCGAGGCCTCCCGCAACGCCGCCGACAAG
GAGCGGGCGGCGGGCGGCGGCGCCGGCAGCAGCGAGGACGACGCGCAGAGCCGCCGCGAC
GAGCAGGACGACGACGACAAGGGCGACTCCAAGGAAACGCGGCTGACCCTGATGGAGGAA
GTGCTCCTGCTGGGCCTCAAGGACCGCGAGGGTTACACATCATTTTGGAATGACTGTATA
TCATCTGGATTACGTGGCTGTATGTTAATTGAATTAGCATTGAGAGGAAGGTTACAACTA
GAGGCTTGTGGAATGAGACGTAAAAGTCTATTAACAAGAAAGGTAATCTGTAAGTCAGAT
GCTCCAACAGGGGATGTTCTTCTTGATGAAGCTCTGAAGCATGTTAAGGAAACTCAGCCT
CCAGAAACGGTCCAGAACTGGATTGAATTACTTAGTGGTGAGACATGGAATCCATTAAAA
TTGCATTATCAGTTAAGAAATGTACGGGAACGATTAGCTAAAAACCTGGTGGAAAAGGGT
GTATTGACAACAGAGAAACAGAACTTCCTACTTTTTGACATGACAACACATCCCCTCACC
AATAACAACATTAAGCAGCGCCTCATCAAGAAAGTACAGGAAGCCGTTCTTGACAAATGG
GTGAATGACCCTCACCGCATGGACAGGCGCTTGCTGGCCCTCATTTACCTGGCTCATGCC
TCGGACGTCCTGGAGAATGCTTTTGCTCCTCTTCTGGACGAGCAGTATGATTTGGCTACC
AAGAGAGTGCGGCAGCTTCTCGACTTAGACCCTGAAGTGGAATGTCTGAAGGCCAACACC
AATGAGGTTCTGTGGGCGGTGGTGGCGGCGTTCACCAAGTAACTCTGCTCGGGGTGAACC
ATTCTCCTTTCTCTCAAGTAAACCAGTAGTTTTTCTTCTGTTGACTTCTGGTTTTCTGTA
ATTTGTACTTTCCCACACTATAATTGGCTTCTGTTTTACAAAATGGTGGGTGGCTTTTTC
TTTTTTGTACGTGTACAGGATTCTGCTGGTACGAGAGGCCTTCCTCTTTCTGTTTTTAAA
AAAAGTTTTACTGCCATATTGGCATTCCATTCCCTGTTGCCATCCTCACTGTTACCTGTT
TTGGGTTTCTGGTCTACTTTGACTTTCAAAGTACCTCCAGCCTCCTCATACGCACAGCTT
TTGGATGACCTCAGCTTGAGTTTCTCCATATGTGCATGTACATCTAGCATTCTGCCTACA
GTTCAGACAGAAGTCACAAAAAGGCCTTCAACTCACCAAAGGTAAATATCTGTATCTATT
AGGACATTTTTTACATAGACTTCAGTTGAGATGTATACTTAGCAAAATTATTTTTAAATT
GAAACAGCACAGTAAATACTTAATATAAAATGTCCCTTGGATTTTGCTTCCCATGTAAAT
CTATTGTATTATTACACTTGTTATAATTTTAACTATAAAGGTCCAATTGTTTCACAGAGC
CAGTTTGGGATGGGCTGCATTCCATTTATGCTGTATATAGTTTGAATTATATATAAATTA
CCCCTTCTTCTGGCCACCCCTGCTCCCATCTTAGTATTTTGCAAGATCTAATCAGTTGTA
CACCTGGTGCCCCTCGCTTGCTTCAATCATGGTTATTTGATGGCAAAATCGACCTCTTGT
CGCTGAAGGAGAGAGAAAAGATGTGTGTCTGATTGGTCCTGGGATTTTTTGAGCTGTGCC
ATTTATGGTACTCTTTGCCTATGCATCCCCTTGTTAGATTTTTTTTAAATTTTATCTTAC
TGTTTTTATAATTTCTATTGGGAAGAGGCTTGTGACCAGTACCAATCTTGAGTTTCTTTT
TCTGTCCACAAGTAAATTAATATCTGCTCTGAAATGTCATTTATCTACTCACACATTCTT
GGGGAAAAAAATCAAATGTCAGTCCTAGCAGATGTTGCATGTAAATTGGTAGCAAGTAAT
GATTACAACCCAGAGGATTAAGAATTTTGTAACAGAAAGCTCTATGTTTTAATTTTTTAT
ATACAATTAGGATAATTAGCATTGTCAGACTATAAACCTTTGCTTTTTAAAGTTTATTTT
TACTATTTCTTTATCACTTTATTGTATCATCACCATTGGTTTCATAATGTAAATACTATA
TGTTGAACAAATTAAATGTCAAAATTTTTTATTACCATAGTCCATGTTAATAGTGGGGCT
TTCAGGTGTTTAGAGATTTTTTTTGTTGTTGTTAACATTCATTGCAAAAGTACTAGATGG
TGTATAACTCTAGAGTTGAATTTTAAGGGATTCCCTAATATGTATACTATCTTTTTATCT
GAAGTAATAAATAAACAATGATCTTGAAAGTGCCTG

Protein Sequence

>64083 : length: 298
MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRL
TLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKV
ICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKN
LVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALI
YLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK