ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

640

Name

BLK

Synonym

MODY11;BLK proto-oncogene, Src family tyrosine kinase;BLK;BLK proto-oncogene, Src family tyrosine kinase

Definition

B lymphoid tyrosine kinase|BLK nonreceptor tyrosine kinase|b lymphocyte kinase|p55-Blk|tyrosine-protein kinase Blk

Position

8p23-p22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

Parkinson disease;PANTHER;P00049

Pathway

Ephrin B reverse signaling;PID Curated;200173

Pathway

Alpha-synuclein signaling;PID Curated;200187

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

EPHA forward signaling;PID Curated;200121

Pathway

Glypican 1 network;PID Curated;200021

Disease

IMMUNE;GAD

Disease

Maturity-onset diabetes of the young, type 11;OMIM

Disease

Rheumatoid arthritis;NHGRI

Disease

Systemic lupus erythematosus;NHGRI

Disease

rheumatoid arthritis;GAD

Disease

systemic lupus erythematosus;GAD

External Links

Links to cell senescence gene database

640

Links to epithelial mesenchymal transition gene database

640

Links to ovarian cancer gene database

640

Links to endometrial cancer gene database

640

Links to iHOP

640

Sequence Information

Nucleotide Sequence

>640 : length: 2689
GAAAGAACGGCTGCCCTGGTGCACACAGATGGCACATGGCAGAGCCCAAGCCCTCTCCAT
GAGATCTGCAGCGTTTGTCCACACGGCAGGGCAAATTACCTTGTAGAGTCAGCATGGAGG
TTTGCTAACTCTGCCGGACTTGGTGCAGAAAAAATACCAGCCGTGCTGTTAAACCAAAAC
CCCAGGAGAAAACTTTCTGGTGACAGAAGGGCATTGTGACCCACGTTGCCCAGGGCCAGG
GACAGGGCAGCTGCTCATGGTCCTTCCTCACGAGTTTTCCTGGAGCAGAGGGATACCCCC
AAACCCAGGGAGCCCACAGGAGCTTCAGAAGGGCTCGGCTGGAGGGCGGGGCCCCTGTTG
CACTTGCTCACTGGGGACTGGGGAGGCTCTGATCGCAGACCGGGGGTGCTGCCACCTCTG
TCTGCTGCCGGCAGAAAGCCACAAGCCATGAAAACTGATTGAGATGAGAAGAATTCATCT
GGGACTGGCTTTTGCTTTAGGATGGTGTTGGAAGTTGCTCGTTGTCGCTAGGAGCCTGCT
CCACTGTAAGGGTGTCAGGATCTGAAGAGCTATGGTGAAACACCACTGAAGCATTGCCAA
GGATGGGGCTGGTAAGTAGCAAAAAGCCGGACAAGGAAAAGCCGATCAAAGAGAAGGACA
AGGGCCAATGGAGCCCCCTGAAGGTCAGCGCCCAAGACAAGGACGCCCCGCCACTGCCGC
CCCTGGTTGTCTTCAACCACCTTACTCCTCCACCGCCCGATGAACACCTGGATGAAGACA
AGCATTTCGTGGTGGCTCTGTATGACTACACCGCTATGAATGATCGGGACCTGCAGATGC
TGAAGGGGGAGAAGCTACAGGTCCTGAAGGGAACTGGAGACTGGTGGCTGGCCAGGTCAC
TCGTCACAGGAAGAGAAGGCTATGTGCCCAGTAACTTTGTGGCCCGAGTGGAGAGCCTGG
AAATGGAAAGGTGGTTCTTTAGATCACAGGGTCGGAAGGAGGCTGAGAGGCAGCTTCTTG
CTCCAATCAACAAGGCCGGCTCCTTTCTTATCAGAGAGAGTGAAACCAACAAAGGTGCCT
TCTCCCTGTCTGTGAAGGATGTCACCACCCAGGGGGAGCTGATCAAGCACTATAAGATCC
GCTGCCTGGATGAAGGGGGCTACTACATCTCCCCCCGGATCACCTTCCCCTCGCTCCAGG
CCCTGGTGCAGCACTATTCTAAGAAGGGGGATGGTCTATGCCAGAGGCTGACCCTGCCCT
GTGTGCGCCCGGCCCCGCAGAATCCCTGGGCCCAGGATGAATGGGAGATCCCCCGGCAGT
CTCTCAGGCTGGTCAGGAAACTCGGGTCTGGACAATTCGGCGAAGTCTGGATGGGTTACT
ACAAAAACAACATGAAGGTGGCCATTAAGACGCTGAAGGAGGGAACCATGTCTCCAGAAG
CCTTTCTGGGTGAGGCCAACGTGATGAAGGCTCTGCAGCACGAGCGGCTGGTCCGACTCT
ACGCAGTGGTCACCAAGGAGCCCATCTACATTGTCACCGAGTACATGGCCAGAGGTGGTG
CCCCCCGCAGAGCCGCATCCTCAGAGCGAGGCGGGAGGGCCGGGCTTAGCAGGAGGAGGA
GGGTCCGCTGCGGATGCCTGCTGGATTTCCTGAAGACAGATGAAGGGAGCAGATTGTCAC
TCCCAAGGCTGATTGACATGTCGGCGCAGATTGCTGAAGGGATGGCATACATTGAGCGCA
TGAATTCCATCCACCGCGACCTGCGGGCGGCCAACATCCTGGTGTCTGAGGCCTTGTGCT
GCAAAATTGCTGATTTTGGCTTGGCTCGAATCATCGACAGTGAATACACGGCCCAAGAGG
GGGCCAAGTTCCCCATCAAGTGGACAGCCCCGGAAGCCATCCACTTCGGGGTCTTCACCA
TCAAAGCAGACGTGTGGTCGTTTGGAGTCCTCCTGATGGAAGTTGTCACTTATGGGCGGG
TGCCATACCCAGGGATGAGCAACCCCGAGGTCATCCGCAACCTGGAGCGCGGCTACCGCA
TGCCGCGCCCCGACACCTGCCCGCCCGAGCTGTACCGCGGCGTCATCGCCGAGTGCTGGC
GCAGCCGGCCCGAGGAGCGGCCCACCTTCGAGTTCCTGCAGTCGGTGCTGGAGGACTTCT
ACACGGCCACCGAGCGGCAGTACGAGCTGCAGCCCTAGCCGGCCGCGCCCGCCTGCGCCC
CGTGCCCACCTCTGCGCGGACGACCCCGACTTCCGTGCCATCCCAGACGGGCCGCGAAGG
CGGGGTGTCGCCTGTGCCCTTTTCTCAGACCCGGAATCCAGTGGGCAGAGGCAGCTTCGC
AGGGGGTCCCCGGACGGACTCCTTCACCGACTGCACCCCCGGGCGAGTTACGCGGCCTCT
CTGTGCCGCTTCATTTGTAGAGGGCTGTAACAGTGACCTCGCACGGTCATCCGGAGTACT
AAGCCCCAGTAAGGTGTTCAGGACTGGTAAGCGACTGTCATCAAGTAAGGCCCCCGTGCT
GGGCACCCCCCGTGCTGGCCGCGTCCCCGCCTCTGCGCCCTGCGTGGACCCCGCCCTGCC
CCGCTACAGAAGCCAGACTGGGTCCCGCGGACGCCAGCAGGGGCAGCCCCAGCCTAGGCT
GCGCTCCAGCACTGCGGGGCTTTTCTGCAATAAAGTCACGAGCGTTCGA

Protein Sequence

>640 : length: 531
MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDK
HFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLE
MERWFFRSQGRKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDVTTQGELIKHYKIR
CLDEGGYYISPRITFPSLQALVQHYSKKGDGLCQRLTLPCVRPAPQNPWAQDEWEIPRQS
LRLVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKALQHERLVRLY
AVVTKEPIYIVTEYMARGGAPRRAASSERGGRAGLSRRRRVRCGCLLDFLKTDEGSRLSL
PRLIDMSAQIAEGMAYIERMNSIHRDLRAANILVSEALCCKIADFGLARIIDSEYTAQEG
AKFPIKWTAPEAIHFGVFTIKADVWSFGVLLMEVVTYGRVPYPGMSNPEVIRNLERGYRM
PRPDTCPPELYRGVIAECWRSRPEERPTFEFLQSVLEDFYTATERQYELQP