ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

63978

Name

PRDM14

Synonym

PFM11;PR domain containing 14;PRDM14;PR domain containing 14

Definition

PR domain zinc finger protein 14|PR domain-containing 14|PR domain-containing protein 14

Position

8q13.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

63978

Links to epithelial mesenchymal transition gene database

63978

Links to ovarian cancer gene database

63978

Links to endometrial cancer gene database

63978

Links to iHOP

63978

Sequence Information

Nucleotide Sequence

>63978 : length: 2344
AATTCCCTACCCTCGACCTGTCGATGCCCCGCGGCCCCGCCCGCCCTCTTAAGCCTGGCT
CAGCCCTCAGGGCCCGCCCGAAGTCTACCGAGCCCGAGTGGCCTACCGAGCCCGAGTGGC
CCCGCAGCGTCCAGGAGGCGCCCGCTCCGCGGTGGCGCTCTTGGAGGTGGTGTCGGAGAG
CCGCCGAGCGTGCGGTCCCGGGATGGCTCTACCCCGGCCAAGTGAGGCCGTGCCTCAGGA
CAAGGTGTGCTACCCGCCGGAGAGCAGCCCGCAGAACCTGGCCGCGTACTACACGCCTTT
CCCGTCCTATGGACACTACAGAAACAGCCTGGCCACCGTGGAGGAAGACTTCCAACCTTT
CCGGCAGCTGGAGGCCGCAGCGTCTGCTGCCCCCGCCATGCCCCCCTTCCCCTTCCGGAT
GGCGCCTCCCTTGCTGAGCCCGGGTCTGGGCCTACAGAGGGAGCCTCTCTACGATCTGCC
CTGGTACAGCAAGCTGCCACCGTGGTACCCAATTCCCCACGTCCCCAGGGAAGTGCCGCC
CTTCCTGAGCAGCAGCCACGAGTACGCGGGTGCCAGCAGTGAAGATCTGGGCCACCAAAT
CATTGGTGGCGACAACGAGAGTGGCCCGTGTTGTGGACCTGACACTTTAATTCCACCGCC
CCCTGCGGATGCTTCTCTGTTACCTGAGGGGCTGAGGACCTCCCAGTTATTACCTTGCTC
ACCCAGCAAGCAGTCAGAGGATGGTCCCAAACCCTCCAACCAAGAAGGGAAGTCCCCTGC
TCGGTTCCAGTTCACGGAGGAGGACCTGCACTTCGTTCTGTACGGGGTCACTCCCAGCCT
GGAGCACCCAGCCAGCCTGCACCATGCGATTTCAGGCCTCCTGGTCCCCCCAGACAGCTC
TGGATCTGATTCTCTTCCTCAAACTCTGGATAAAGACTCCCTTCAACTTCCAGAAGGTCT
ATGCCTCATGCAGACGGTGTTTGGTGAAGTCCCACATTTTGGTGTGTTCTGCAGTAGTTT
TATCGCCAAAGGAGTCAGGTTTGGGCCCTTTCAAGGTAAAGTGGTCAATGCCAGTGAAGT
GAAGACCTACGGAGACAATTCTGTGATGTGGGAGATCTTTGAAGATGGTCATTTGAGCCA
CTTTATAGATGGAAAAGGAGGTACGGGGAACTGGATGTCCTATGTCAACTGTGCCCGCTT
CCCCAAGGAGCAGAACCTAGTTGCTGTGCAGTGTCAAGGGCATATATTTTATGAGAGCTG
CAAAGAGATCCATCAGAACCAAGAGCTCCTTGTGTGGTATGGAGACTGCTATGAGAAATT
TCTGGATATTCCTGTGAGCCTTCAGGTCACAGAGCCGGGGAAGCAGCCATCTGGGCCCTC
TGAAGAGTCTGCAGAAGGCTACAGATGTGAAAGATGTGGGAAGGTATTTACCTACAAATA
TTACAGAGATAAGCACCTCAAGTACACCCCCTGTGTGGACAAGGGCGATAGGAAATTTCC
CTGTTCTCTCTGCAAACGATCCTTTGAGAAGCGGGACCGGCTTCGGATCCACATTCTTCA
TGTTCATGAGAAGCACCGGCCTCACAAGTGTTCTACATGTGGGAAATGTTTCTCTCAATC
TTCCAGCCTAAACAAACACATGCGAGTCCACTCTGGAGACAGACCATACCAGTGTGTGTA
TTGTACTAAGAGGTTCACAGCCTCCAGCATACTCCGCACACACATCAGGCAGCACTCCGG
GGAGAAGCCCTTCAAATGCAAGTACTGTGGTAAATCTTTTGCATCCCATGCTGCCCATGA
CAGCCATGTCCGGCGTTCACACAAGGAGGATGATGGCTGCTCATGCAGCATCTGTGGGAA
AATCTTCTCAGATCAAGAAACATTCTACTCCCACATGAAGTTTCATGAAGACTACTAGCC
CTGCCAGGCACAATGACTCACGCCTGTAATCCCAGCACTTTGGGAGGCAGAGGTGGGTGG
ATCACTCAAGTCCAGGAGTTCGAGACCAGCCTGGGCAACATGGTGAAATCCTGTCTCTAC
CAAAAAAATACAAAAATCAGCTGGGGGTGGTGGCACATGCCTGTGGTTCCAGCCACTCAG
GAGGTCGAGGTGGCAGGATGGTTTGAGCACAGGAGACGGAGGTTGCTGTGAGCTGAGATC
GCCCCACTGCTTTTCAACCTGGGTGACAGAACCAGACCCTGTCTCAAAACAAAACAAAAC
AAAAAAAATGAGTAGCCCTCAAGAGTGTGGAGACAATGTAAAAACAAGAGATTCGGATTC
TCTCTATTTCCTTTTATGGGTTATAGAAGTCCCTGCAGTTGGCTGTGTGTGGTGGCTCAC
GCCT

Protein Sequence

>63978 : length: 571
MALPRPSEAVPQDKVCYPPESSPQNLAAYYTPFPSYGHYRNSLATVEEDFQPFRQLEAAA
SAAPAMPPFPFRMAPPLLSPGLGLQREPLYDLPWYSKLPPWYPIPHVPREVPPFLSSSHE
YAGASSEDLGHQIIGGDNESGPCCGPDTLIPPPPADASLLPEGLRTSQLLPCSPSKQSED
GPKPSNQEGKSPARFQFTEEDLHFVLYGVTPSLEHPASLHHAISGLLVPPDSSGSDSLPQ
TLDKDSLQLPEGLCLMQTVFGEVPHFGVFCSSFIAKGVRFGPFQGKVVNASEVKTYGDNS
VMWEIFEDGHLSHFIDGKGGTGNWMSYVNCARFPKEQNLVAVQCQGHIFYESCKEIHQNQ
ELLVWYGDCYEKFLDIPVSLQVTEPGKQPSGPSEESAEGYRCERCGKVFTYKYYRDKHLK
YTPCVDKGDRKFPCSLCKRSFEKRDRLRIHILHVHEKHRPHKCSTCGKCFSQSSSLNKHM
RVHSGDRPYQCVYCTKRFTASSILRTHIRQHSGEKPFKCKYCGKSFASHAAHDSHVRRSH
KEDDGCSCSICGKIFSDQETFYSHMKFHEDY