ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

63977

Name

PRDM15

Synonym

C21orf83|PFM15|ZNF298;PR domain containing 15;PRDM15;PR domain containing 15

Definition

PR domain zinc finger protein 15|zinc finger protein 298

Position

21q22.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

63977

Links to epithelial mesenchymal transition gene database

63977

Links to ovarian cancer gene database

63977

Links to endometrial cancer gene database

63977

Links to iHOP

63977

Sequence Information

Nucleotide Sequence

>63977 : length: 8995
GGGCTGTCTGAGGAGGGGCCACAGTGGAGACCAGTGCTGTGAGGGAGCCTCTGGTGGAGG
TGGGTGCGGTGGTGCCTGCCCCCACCAGGCAGATGGTGGCAAATGCAAAGGCCCTGGGGT
GGGATGAGCCCAGGATGGGACAGGCCAGTGTGGCCATGGAGGTGGGGCAGCAGGGGCCAT
GCACCAGGCAGAGATTTTCTTCTGACTGCCTTGTGGATGCCACTGAGGGGCTTTGAGCAG
TGGCGGGGCAGAGTCTGCATCTTTTGGCTGTGTGTGGGGAATGGAGCTGGCATCACTGGA
ATCCAGGCCCTGCATGATTCCACTCCACAGAACTCGGAGGCAGAAGGGGAGATGGGGCAG
GACAGAGCCTAGTTCCAGAGCCAGGCAGGCCTGCTGCTGGTTTGGTTGGAAATGCATGGT
GGGTGACTGGAGCTACTATTTACTGAGGTGCAGGTGACCTGAGGCATTCAGGGGCCCTGT
AGAGCAGACATCTTCAAACTCTCCCTCAGAGTGGGAGAAGACCCTGCCCCGGGGCCACGT
CCGCTCCTCAAAAGGCTCCTCCTAAGGAAAGGTCCCTCCTCTTGCAGTCATGGCCCTGGG
GTGTGGAAACTGCGGGGTCCCAGCAGATGTAAGGGTGTTGGGGAGTGGCTCCCCCGTGGG
CCACAGGTCTGCAGCAGCTGCGGGAGCCTCTACACCAGCGGTGTTCATGGTGATCGTTGA
TGACAAGTTGATCTTTGATGAATTCAGGCTCAGAACTCAAGAGGATGTGGCATTGGGGGA
CTCTGCTGTGACCAAGCCCCTTCTGCTCCCGTCTCCTTATTTCTGGAACCAGCTTCTCTG
TGCTCGCATTTCTAGAAAGAGGAATAGGGACAGAGGCGAGCATTTGTCCATGCTATGTGA
ACTGATTAGGGGAAAAAAGCTCTTTCTCTTCTATTAAACACAGCTTTTATATCAGATGAT
GATTTATCGAAGTGGAGACTATTTCTGTTTTGATCAGTGGTGTTCCAATTGTAGTCACAC
TGTGAAAAGGAGATATGGTTCAATGGTGGACCGCATATACCATGCTGGTCCTGTAAGATG
ATAGGACCGCATTTTTTACGTTACCTTTTCTATGTTTAGATAAGCAAATACTTACTATTG
TGTTACAGGTACCTACAGTATTCCGTTAGTTAAGTGCTGTACAGGTTTGCAGCCTAGGAG
TCGTAGGCTGGGCCGTATAGCCTAGGTGTGTAGTAGGCTATACCATCTAGGGTTGTGTAT
GTACACTCTATCATGTTTGCACAACTACAAAATCCCATAGCAATGCATTTCTCAGAATCC
TGTCAGGAAGCTACACACGAGTGTACTGCGGTGATGATTCGGGAGACGTTAGCACAGCCC
TATGGTTGTAGGAAATCAAGACGAATTCAATTTATATGCATGTTTGTGTTGCAAAAAGTT
ACAGTAGGGTGAATCAATAGAGTGATTTCAAGCATGAATATATAACGTTGGGTTTACATT
TTGTAGTAACAGAAATAGGAGTTCCTAGAGGAAGAAGTGTATACTTTCTGGCCTTAAGAA
GAGCTTGTTCGTGTGCGTTGTAAATAGATGGCCATGGCTGTCACGTCACCGTGCCTAGAT
TCTAATAGATATATTTACAAGAGTGACATGGCAGTTTTATTTTAACTCAGTATTTACAGT
ATGCTGGAAATGATGTCCCTTGCAGCTGTTTAAAACAGGGATGAACAGTTTATACTGTCA
GCTGAGATGCAGGGAGTGGCATTTTAGGAAATATTTTCATGGGGATACTGGCAAAACTCA
AAGAGCCTGGCTGCTCCTGGTTCCAGGCATCAGGTGGAGCTGCCGTCCGGGGCCTGGCAG
GGCGAGGGGCCGCCAGGATGCCGGCTTGGGAGTTGGGGGTGGCAGGTAAGTGCTGCATGT
AGAGGGACGGAGGTCTAGGTAGCCAGCTTGGGGTACCCCCTGTGGAGGCTCTGGAGGGGA
GGTGCAGACAGCAAAGGGGCTTAGGAGGGAGCACGCAGTGAGAGGGACCCTCCAGGGCAG
AAGGGATTTCCAGAGGAGGCAGTAAGGATGGCTTCGGGTGGAGAGGACCTGGGATTGGGC
AGGGACCCTGCTGAAGCCACTCGTCCTACATGAATCCTACTCAGAGCAGGAGAAGCCAAG
ATCAGCGATCCTCCCGTCTTGGCCCCCCAAAGTGCTGGGATGACAGGTGTCAGCCTGTCC
TGGAGTCCTCCAAGCCCGTGGGGTCTGATGAGCACAGACGGCTCAGCTCTTCCTTGCTTC
CATACCCTTACATAAAACTGGAGCTCGGCTTTCTCAGAGAGGATGCTTTTATTTGCCTGA
GATGCACCATCTGTTACTGGCTCCGTTTGACCGATCTCCTTGTTCATCGTGGTCCAGGTC
TGCACCTGACAGCTCTGAGTGCTGACCTACTGCAGGCGTCATCAGTAAACCTTGACTAAG
TGATGCGGCTCACGGCAAACTCACTGTGTCAGAGATGGCTGAAGATGGGAGCGAAGAGAT
CATGTTCATCTGGTGTGAAGACTGCAGCCAGTACCACGACTCCGAATGTCCCGAGCTGGG
CCCAGTGGTCATGGTCAAAGACTCCTTTGTGTTAAGCAGGGCAAGGTCATCCCTTCCTCC
CAACTTGGAGATCAGACGACTGGAAGATGGAGCCGAGGGGGTGTTCGCCATCACTCAGCT
CGTCAAGCGGACACAGTTCGGTCCCTTTGAGTCCAGGAGGGTCGCCAAATGGGAAAAGGA
GTCTGCATTTCCCCTGAAGGTGTTCCAGAAGGACGGGCACCCCGTGTGCTTCGACACCTC
CAACGAGGATGACTGCAACTGGATGATGCTGGTGCGGCCAGCGGCGGAGGCCGAGCACCA
GAACCTGACGGCCTACCAGCACGGCAGCGACGTGTACTTCACCACCTCCAGAGACATCCC
CCCGGGTACCGAGCTGCGCGTGTGGTATGCGGCCTTCTATGCCAAGAAGATGGACAAGCC
CATGCTGAAGCAGGCCGGCTCTGGCGTCCACGCTGCAGGCACCCCAGAAAACAGCGCCCC
CGTGGAGTCGGAGCCCAGCCAGTGGGCGTGTAAAGTGTGTTCTGCCACCTTCCTGGAGCT
GCAGCTCCTCAATGAACATCTGTTGGGCCACTTAGAACAAGCCAAAAGCCTTCCTCCAGG
CAGCCAAAGCGAGGCAGCAGCTCCCGAGAAGGAGCAGGACACACCCCGGGGGGAACCCCC
TGCAGTGCCCGAGAGCGAGAATGTTGCCACCAAAGAACAGAAGAAAAAGCCTCGAAGGGG
GAGAAAACCCAAAGTGTCCAAAGCTGAGCAGCCTCTAGTCATCGTGGAAGACAAGGAACC
CACAGAGCAAGTGGCAGAGATCATTACCGAGGTCCCTCCGGATGAGCCTGTGAGTGCAAC
GCCAGATGAGCGGATCATGGAGCTGGTTCTGGGGAAGCTGGCCACCACCACCACTGACAC
CAGCTCGGTTCCAAAGTTCACCCATCATCAGAATAACACCATCACGCTCAAGAGGAGCTT
AATTCTCTCAAGCAGACACGGCATCCGGCGCAAGCTCATCAAACAGCTCGGGGAGCACAA
GCGGGTTTACCAGTGCAATATCTGCAGCAAGATCTTCCAGAACAGCAGCAACCTGAGCAG
GCACGTGCGCTCGCATGGTGACAAGCTGTTTAAGTGCGAAGAGTGTGCAAAATTGTTCAG
CCGCAAAGAGAGCCTAAAGCAGCACGTTTCCTACAAGCACAGCAGGAACGAGGTGGACGG
CGAGTACAGGTACCGCTGCGGCACTTGTGAGAAGACCTTCCGCATCGAGAGCGCGCTGGA
GTTCCACAACTGCAGGACAGGACTCATAGCACACCCTGGAGAGGGGGGGCCCGGCGGCAG
TCGGCTTAGAGACCTACCAGATGACAAGACGTTCCAATGTGAGATGTGTTTCAGATTCTT
CTCCACCAACAGCAACCTCTCCAAGCACAAGAAGAAGCACGGCGACAAGAAGTTTGCCTG
TGAGGTCTGCAGCAAGATGTTCTACCGCAAGGACGTCATGCTGGACCACCAGCGCCGGCA
CCTGGAAGGAGTGCGGCGAGTGAAGCGAGAGGACCTGGAGGCCGGTGGGGAGAACCTGGT
CCGTTACAAGAAGGAGCCTTCCGGGTGCCCGGTGTGTGGCAAGGTGTTCTCCTGCCGGAG
CAATATGAACAAGCACCTGCTCACCCACGGCGACAAGAAGTACACCTGCGAGATCTGCGG
GCGCAAGTTCTTCCGCGTGGATGTGCTCAGGGACCACATCCATGTCCACTTCAAGGACAT
CGCGTTGATGGATGACCACCAGAGGGAAGAGTTTATCGGCAAGATCGGGATCTCCTCGGA
AGAAAACGATGACAATTCTGACGAGAGCGCAGACTCGGAGCCTCACAAGTACAGCTGCAA
GCGGTGCCAGCTCACCTTCGGCCGGGGGAAGGAGTACCTGAAGCACATCATGGAGGTGCA
CAAGGAGAAGGGCTATGGCTGCAGCATCTGCAACCGGCGCTTTGCACTGAAGGCCACCTA
CCACGCCCACATGGTCATCCACCGTGAAAACCTGCCGGACCCCAACGTGCAGAAGTACAT
CCACCCCTGCGAGATCTGCGGGCGGATCTTCAACAGCATCGGGAACCTGGAGCGCCACAA
GCTCATCCACACAGGTGTGAAGAGCCACGCCTGCGAGCAGTGTGGGAAGTCCTTTGCCAG
GAAGGACATGCTGAAGGAGCACATGCGTGTGCACGACAATGTCCGCGAGTACCTGTGTGC
CGAGTGTGGGAAAGGCATGAAGACCAAGCACGCGCTGCGCCACCACATGAAGCTGCACAA
GGGCATCAAGGAGTACGAGTGCAAGGAGTGCCACCGCAGGTTCGCGCAGAAGGTCAACAT
GCTCAAGCACTGCAAGCGGCACACGGGGATTAAAGATTTCATGTGTGAATTGTGTGGGAA
GACATTCAGCGAGAGGAACACCATGGAGACCCACAAGCTCATCCACACAGTGGGCAAGCA
GTGGACGTGCTCCGTGTGCGACAAGAAGTACGTGACCGAGTACATGCTGCAGAAGCACGT
TCAGCTCACACACGACAAGGTGGAGGCGCAGAGCTGCCAGCTGTGCGGGACCAAGGTGTC
CACCAGGGCCTCCATGAGCCGACACATGCGGCGCAAGCACCCCGAGGTGCTCGCGGTGAG
GATCGATGACCTGGACCACCTCCCGGAGACCACCACCATCGACGCCTCCTCCATTGGCAT
CGTCCAGCCTGAGCTGACTCTGGAGCAGGAGGATTTGGCCGAAGGGAAGCACGGGAAAGC
TGCCAAGCGAAGTCACAAGAGAAAGCAGAAGCCAGAAGAGGAGGCGGGTGCTCCGGTGCC
CGAGGACGCCACCTTCAGCGAATACTCAGAGAAAGAGACGGAGTTCACAGGCAGTGTAGG
CGACGAGACCAATTCCGCAGTACAGAGCATTCAGCAGGTAGTGGTGACCCTGGGTGACCC
AAATGTGACCACACCATCGAGCTCAGTCGGCTTAACCAACATCACCGTGACCCCCATCAC
CACTGCGGCCGCGACTCAGTTTACCAATCTCCAGCCGGTGGCCGTGGGGCACCTTACCAC
CCCTGAACGCCAGTTACAGCTGGACAACTCAATCCTGACCGTGACCTTTGATACCGTCAG
CGGCTCTGCCATGTTGCACAACCGCCAAAATGACGTCCAGATCCACCCCCAGCCGGAAGC
CTCGAACCCACAGTCTGTGGCCCATTTCATCAACCTGACGACCCTGGTCAACTCCATCAC
GCCCCTGGGGAGCCAGCTTAGTGACCAGCACCCGCTCACGTGGCGGGCAGTGCCCCAGAC
TGACGTCTTGCCACCCTCGCAGCCGCAGGCACCCCCACAGCAGGCGGCCCAGCCCCAGGT
GCAGGCGGAGCAGCAGCAGCAGCAGATGTACAGCTACTGAGCTGCGTTCCGGGAGACTCG
GGGCAAGAACTGCAGAGGGATGTTTGGGATTTGTTTAGATGTGTTTGCTGGATACCAAAC
AAACAAAAAGTCATACATTGCAATGTAAGGTTGACTTAGCTTTGCAGAGTATCTCCAGAT
CCCCCGCCAGCAACCATTACGGTCTGTCAGCTTAACTCTAGAAGGGACCTCTGGCAGGCC
AGAGTTTTAAACTGGATGGGGCTCCACACCATGCCTTACCAAGGCAGTAAGTCCTGGGCC
GGGGCCGCATCTGCCTCCCCTTACAGAACCAGTGTTCGCCCGACACAGGGTTCGGGAAAG
TGAAGCTGAGAGAGAAGCAGGATTTTAAGAGGCAGGAGATAAGTTATTAGGAACACAAAT
GGTTCATTTTCTTTTTTCTTTTAGAGCTCGGTTCCTATGAGAACACAGACAGTATTCACA
GGTGGCAGCAGGCAGCAGGGAACATTTTCTCCTCACTTCTGGATTTTTTTGCAAGCGAGC
ACATAGAAGTTAAAGTAACGTGTATTCTCTTTGAACTAGGAGTGGAGTCGGTTCTTATAC
AACTATGGGCTGAAACCATGAGGCGTGCTGAGCCGCACCTGATCCTGCAACCTTCGAGGT
CATCACGGTCATCATGTGCAAGGGGTCACGTGAGGTCACTGACTCCAGCTCAAAACGCAT
CTTAGTAATATCCATGAATCGATTTCCAATAGAGTTTTTTTCCTTTTTTTTTTTTAACTT
TATTTCAAACATACATTATGTGTTCAAGACTGTTATGGCCAATATTGTGTTTTAGTTTTA
TGTTAACATGATAAAGTCATGTGCACTGTAGGACCATCTGTCCCTGTCCACCCTTCACAG
CTGCCCAGATGCAGAGGGTCGCGCGGCTGTGTGTGAGGAGTGAGCCTCCCTGCTGCCCCC
AGGGGCTCCTCCGGGTTGTCTCAGGATTCTCTGCAATCCAAATGTATCCATTCTGGCTGA
AGCCCAGCCAGAATCCCGAGTGGAAGAAACGGGGGAAAAGTCATATTTTCCTTCTGTTTA
AACTTCAATTCCAAAGGTTGGTGTATTTCATGACCAGTTTTCTATAAAAATATTGAATGA
GTTTGGCTCTTTACAATGGAAAAGTGTAGGTATTTCTGAAACACAGAGAAAATGCTATTT
CCTGCCAGGTGGTAATGAAAGCAGAGAGGTTAGTTCACTAATAGAAGCATTAATTGCCCC
TAAAACTGAATGTGCGGTGAACAGCCAGGTCTGCGTGTGCGGGGACACGTGCTGTCACGT
CTGTGTACCAGTTTCGGGGGCAGGGGCCAGGGTTGGGGGAGGCACCCAGCCCTCCTGCTG
CCCACGACAAGAAACACTGAGAGGTGTGGGGAGAAGTTTGCTCTTAACTTTCCTGGTACT
CTGTTTGTGGCCACAGTGAGAGGACAAACCTGCCTTAAGGTGTCCTGCTTTGCCAGTTAT
CCCAGATCCTGCACTCACTGGGAGTCCATCTTGAGGAAACACTGGCATGGCTGAGTAATT
GATCAGGAGCAGTCCTGATGTTGCCAGCAGAACAAAGGATGATTGTGTTTTTCAAAACGC
AACTTTCTCAGCACTTCACTCCAAACAGCAGACTTTTGAGGACAGGGCTGGAATTTGTTT
TGTGCAATATATGCCTTCATGAACTAAGGAATGTTCATCCCCAGGCAGCATGCAGGAGGG
TCTGTGGGGCTCACCTCCTCACCTTACCCACCATCACTCGCGCCTAGCTCTCACCTCTCA
GTTGAATGAATAGTGGGAGATCATTTGACTTTTAATTTATGAGAATTATTTTATGTTATT
TATGTATATAATTAACTGTTTTATACATAGTAGTCTCATCAAATGAATTCGGGCTTGGGG
TGATATTGTCTCCATTCTCCAGATACAAGTGCTCCAGGCATCCATGGAATCAGCAGGAGA
CCAGGGCTCCTAAGATATATTTTTAAAAATCAGTATCGATTTCTTTTTGCCTTTGCAGAA
TCTAAAGGGCAAATGACCTCGCAGAGACTCCCAACGGGCTTTGGGCTCATGACGAAACAC
CCACTAGCATTGATCTTTTATTCCTCTTCCCTATAAAATAAAGGCCTTGGAAATCACAAT
TTTATTTTTTTAAAGAAGTTGTTTTAGTGCCTAGAGTAAGACCGCATCAAATGTTGTTAA
AGAACCTAATTTAGATTGTGTGGTATATACCACTGTTTATCTCAATACACAGACACCTCT
TACTTCTTGTTATAAGTGAGAACTCTAAAGAAAAATCAAACTCCCAAGTTTTCTGTAAAC
ATACGTGGTCTTAATAGGGTCACTGTCTGAGGCAAAATGGGTTGTCTTAAAGCAATTGCT
ACAAATTTGCATCAAAGAAACTAGATAGCAAAATACAACAACCATGTACCACCCAGGCAG
AAGAGTCCTCACCTATACGCAGTTCTGCATATTGATCATCATGACAGGAAGTATTTCGTT
TTTTAACTGATCCCAGGTGCACAGATGTATTCATAAAGGAAGACATTAGATCCAGCCATT
GTGGCCACCAGGCTCTGTGGACCCATCTCAGTGGAGAATTCGTTTTGGACCCGTGGCTCC
GTGCAGCTGTGGACTCGAGTGCCATCCACTGGTGTGAGTCTTGCGGGGAGGCCACAGGTA
CAGCTGCTCCCCGTGAATCCTGGTCTGTGGGTTGAGAAGGGGCTCGGGCCTCTGGAATGC
TCTAGCGTGTGACGTGTTCTCAGGAAAACGTTCTGTGCCAAGTGCCGCCTCGCTGTGTCC
GGCATGGGACTGCGCTGGAGGGTCCGGCGTGGAAGGCAGACCTCCTGTACCTCTATCGTT
CCCATTTGTGGCATCCAAAGGCGGAAGGCTCATGGCTTCCCCACTAGAGGCGGCGTCTTG
GGCTTTCCCATTGGATTGTGAAAGGCATTAAGACTGTTTGGAGATGTTGGCTGTATTTCC
TGTCACATCAGGTTGTATGATGACGAATAAAAGGTGCTGTGACCCGTGTTTTCAA

Protein Sequence

>63977 : length: 1507
MPRRRPPASGAAQFPERIATRSPDPIPLCTFQRQPRAAPVQPPCRLFFVTFAGCGHRWRS
ESKPGWISRSRSGIALRAARPPGSSPPRPAAPRPPPPGGVVAEAPGDVVIPRPRVQPMRV
ARGGPWTPNPAFREAESWSQIGNQRVSEQLLETSLGNEVSDTEPLSPASAGLRRNPALPP
GPFAQNFSWGNQENLPPALGKIANGGGTGAGKAECGYETESHLLEPHEIPLNVNTHKFSD
CEFPYEFCTVCFSPFKLLGMSGVEGVWNQHSRSASMHTFLNHSATGIREAGCRKDMPVSE
MAEDGSEEIMFIWCEDCSQYHDSECPELGPVVMVKDSFVLSRARSWPASGHVHTQAGQGM
RGYEDRDRADPQQLPEAVPAGLVRRLSGQQLPCRSTLTWGRLCHLVAQGRSSLPPNLEIR
RLEDGAEGVFAITQLVKRTQFGPFESRRVAKWEKESAFPLKVFQKDGHPVCFDTSNEDDC
NWMMLVRPAAEAEHQNLTAYQHGSDVYFTTSRDIPPGTELRVWYAAFYAKKMDKPMLKQA
GSGVHAAGTPENSAPVESEPSQWACKVCSATFLELQLLNEHLLGHLEQAKSLPPGSQSEA
AAPEKEQDTPRGEPPAVPESENVATKEQKKKPRRGRKPKVSKAEQPLVIVEDKEPTEQVA
EIITEVPPDEPVSATPDERIMELVLGKLATTTTDTSSVPKFTHHQNNTITLKRSLILSSR
HGIRRKLIKQLGEHKRVYQCNICSKIFQNSSNLSRHVRSHGDKLFKCEECAKLFSRKESL
KQHVSYKHSRNEVDGEYRYRCGTCEKTFRIESALEFHNCRTDDKTFQCEMCFRFFSTNSN
LSKHKKKHGDKKFACEVCSKMFYRKDVMLDHQRRHLEGVRRVKREDLEAGGENLVRYKKE
PSGCPVCGKVFSCRSNMNKHLLTHGDKKYTCEICGRKFFRVDVLRDHIHVHFKDIALMDD
HQREEFIGKIGISSEENDDNSDESADSEPHKYSCKRCQLTFGRGKEYLKHIMEVHKEKGY
GCSICNRRFALKATYHAHMVIHRENLPDPNVQKYIHPCEICGRIFNSIGNLERHKLIHTG
VKSHACEQCGKSFARKDMLKEHMRVHDNVREYLCAECGKGMKTKHALRHHMKLHKGIKEY
ECKECHRRFAQKVNMLKHCKRHTGIKDFMCELCGKTFSERNTMETHKLIHTVGKQWTCSV
CDKKYVTEYMLQKHVQLTHDKVEAQSCQLCGTKVSTRASMSRHMRRKHPEVLAVRIDDLD
HLPETTTIDASSIGIVQPELTLEQEDLAEGKHGKAAKRSHKRKQKPEEEAGAPVPEDATF
SEYSEKETEFTGSVGDETNSAVQSIQQVVVTLGDPNVTTPSSSVGLTNITVTPITTAAAT
QFTNLQPVAVGHLTTPERQLQLDNSILTVTFDTVSGSAMLHNRQNDVQIHPQPEASNPQS
VAHFINLTTLVNSITPLGSQLSDQHPLTWRAVPQTDVLPPSQPQAPPQQAAQPQVQAEQQ
QQQMYSY