ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

63976

Name

PRDM16

Synonym

CMD1LL|LVNC8|MEL1|PFM13;PR domain containing 16;PRDM16;PR domain containing 16

Definition

MDS1/EVI1-like gene 1|PR domain zinc finger protein 16|transcription factor MEL1

Position

1p36.23-p33

Gene Type

protein-coding

External Links

Links to cell senescence gene database

63976

Links to epithelial mesenchymal transition gene database

63976

Links to ovarian cancer gene database

63976

Links to endometrial cancer gene database

63976

Links to iHOP

63976

Sequence Information

Nucleotide Sequence

>63976 : length: 9677
GGGCGCGGCGGCAGGAGAGCGCGGGCGGAGAGGTGCGGGCGCCCTGGGACGACCAGCCGA
GGACGCCTGGTGTTTGGACGGCTGCCCCCGCGCTGTCCCCCCGTGCGAGGCGTGTTGGCC
TCCGTGGCCTCGCGAGGGACCGAGGGCGGCGGGTCCGAGTGCCGCCCGCCGGCCTGGGCA
GTGGCGGAGCGCGGAGCTGGCGGCGCCTCCGCTGTTGTTTTTGAGCCGCGAAGCCCGAAG
CAGCAGCCGTTGGGTGGGGGCGAAGGGGAGGAGGCGGGGGCCGGGAGGCGCGAGGGGGGC
GGTGGGGCCCGGAGGGGGCTTCGGAGGAGCCGGGTTCTGGCGCGCGAGCCCCGACGCCCC
CTCCAGCGATCGCAGGGCGGGGACGGGGGCCGAGGGGAGAATGCAGGAGAAAAGCGGGCC
GGGGCGACGGGGAACGCAAAGCTTTTAAATTAGTAATCAAACGCAGTAAAACGGAGCAAA
ACCAGCCCGGACTCGCGTCCGAACTATCGGCGCGTGTGCCCCGAGATCCAAGGAAGTCGT
GTGGAAAACCGCAGCCGCCGCCCCATCTTCGGCCCCGGCTGGGGCGGGAGCAGCAGCGCG
ACGCGCCGCGACGCAGGGGCAGGGTGGGGGGATAGTCACCTCGCCTCCGGGGCCACCTGG
GTCCTTTTAAAGTGTCCGGGGTGCGGGCCCCGGGCGGGAGCGCCGAACACGGAATGTTTT
CTTAAAGGGCCAGTTCCGAGCTGCGCTGAAAAGGGGGGGGGGGAGAGGGGGGAGAGATAA
GTGAGACGAAGACCGAGAAGGCCGAGGAGAGCCCCCCAATCCCGCGCCGAGGCGGCGGCG
GCGGCGGCGGCGGCGCGACGATGAGGATGATGAATACATTGCAAAGTTTTTTTGGCCCCG
GCGAGGGGTGTCAGATTGAGTGCTCTGTGCGCATGTGCGAAGGTGTCCAAACTGACAATG
CTGGGGAGATGAAGATAGTGTGTGGCTGCTTCTGGACTCAAGGAGGAGGAGAGAGATTCC
GCGAGCCGACACCATGCGATCCAAGGCGAGGGCGAGGAAGCTAGCCAAAAGTGACGGTGA
CGTTGTAAATAATATGTATGAGCCCAACCGGGACCTGCTGGCCAGCCACAGCGCGGAGGA
CGAGGCCGAGGACAGTGCCATGTCGCCCATCCCCGTGGGGCCACCGTCCCCCTTCCCCAC
CAGCGAGGACTTCACCCCCAAGGAGGGCTCGCCGTACGAGGCCCCTGTCTACATTCCTGA
AGACATTCCGATCCCAGCAGACTTCGAGCTCCGAGAGTCCTCCATCCCAGGGGCTGGCCT
GGGGGTCTGGGCCAAGAGGAAGATGGAAGCCGGGGAGAGGCTGGGCCCCTGCGTGGTGGT
GCCCCGGGCGGCGGCAAAGGAGACAGACTTCGGATGGGAGCAAATACTGACGGACGTGGA
AGTGTCGCCCCAGGAAGGCTGCATCACAAAGCAGATCTCCGAAGACCTGGGCAGTGAGAA
GTTCTGCGTGGATGCAAATCAGGCGGGGGCTGGCAGCTGGCTCAAGTACATCCGTGTGGC
GTGCTCCTGCGATGACCAGAACCTCACCATGTGTCAGATCAGTGAGCAGATTTACTATAA
AGTCATTAAGGACATTGAGCCAGGTGAGGAGCTGCTGGTGCACGTGAAGGAAGGCGTCTA
CCCCCTGGGCACAGTGCCGCCCGGCCTGGACGAGGAGCCCACGTTCCGCTGTGACGAGTG
TGACGAACTCTTCCAGTCCAAGCTGGACCTGCGGCGCCATAAGAAGTACACGTGTGGCTC
AGTGGGGGCTGCGCTCTACGAGGGCCTGGCTGAGGAGCTCAAGCCCGAGGGCCTTGGCGG
TGGCAGCGGCCAAGCCCACGAGTGCAAGGACTGCGAGCGGATGTTCCCCAACAAGTACAG
CCTGGAGCAGCACATGGTCATCCACACGGAGGAGCGCGAGTACAAATGCGACCAGTGTCC
CAAGGCCTTCAACTGGAAGTCCAACCTCATCCGCCACCAGATGTCCCACGACAGCGGCAA
ACGCTTCGAATGTGAAAACTGCGTGAAGGTGTTCACGGACCCCAGCAACCTTCAGCGGCA
CATCCGCTCGCAGCACGTGGGCGCTCGGGCCCACGCCTGCCCCGACTGCGGGAAGACCTT
CGCCACGTCCTCCGGCCTCAAGCAGCACAAGCATATCCACAGCACGGTGAAGCCTTTCAT
ATGTGAGGTCTGCCACAAGTCCTACACGCAGTTCTCCAACCTGTGCCGGCACAAGCGGAT
GCACGCCGACTGCCGCACGCAGATCAAGTGCAAGGACTGTGGCCAGATGTTCAGCACTAC
CTCCTCCCTCAACAAGCACCGGCGCTTCTGCGAGGGCAAGAACCATTACACGCCGGGCGG
CATCTTTGCCCCGGGCCTGCCCTTGACCCCCAGCCCCATGATGGACAAGGCAAAACCCTC
CCCCAGCCTCAATCACGCCAGCCTGGGCTTCAACGAGTACTTTCCCTCCAGGCCGCACCC
GGGGAGCCTGCCCTTCTCCACGGCGCCTCCCACGTTCCCCGCACTCACCCCCGGCTTCCC
GGGCATCTTCCCTCCATCCTTGTACCCCCGGCCGCCTCTGCTACCTCCCACATCGCTGCT
CAAGAGCCCCCTGAACCACACCCAGGACGCCAAGCTCCCCAGTCCCCTGGGGAACCCAGC
CCTGCCCCTGGTCTCCGCCGTCAGCAACAGCAGCCAGGGCACGACGGCAGCTGCGGGGCC
CGAGGAGAAGTTCGAGAGCCGCCTGGAGGACTCCTGTGTGGAGAAGCTGAAGACCAGGAG
CAGCGACATGTCGGACGGCAGTGACTTTGAGGACGTCAACACCACCACGGGGACCGACCT
GGACACGACCACGGGGACGGGCTCGGACCTGGACAGCGACGTGGACAGCGACCCTGACAA
GGACAAGGGCAAGGGCAAGTCCGCCGAGGGCCAGCCCAAGTTTGGGGGCGGCTTGGCGCC
CCCGGGGGCCCCGAACAGCGTGGCCGAGGTGCCTGTCTTCTATTCCCAGCACTCATTCTT
CCCGCCACCCGACGAGCAGCTGCTGACTGCAACGGGCGCCGCCGGGGACTCCATCAAGGC
CATCGCATCCATTGCCGAGAAGTACTTTGGCCCCGGCTTCATGGGGATGCAGGAGAAGAA
GCTGGGCTCGCTCCCCTACCACTCGGCGTTCCCCTTCCAGTTCCTGCCCAACTTCCCCCA
CTCCCTTTACCCCTTCACGGACCGAGCCCTCGCCCACAACTTGCTGGTCAAGGCCGAGCC
AAAGTCACCCCGGGACGCCCTCAAGGTGGGCGGCCCCAGTGCCGAGTGCCCCTTTGATCT
CACCACCAAGCCCAAAGACGTGAAGCCCATCCTGCCCATGCCCAAGGGCCCCTCGGCCCC
CGCATCCGGCGAGGAGCAGCCGCTGGACCTGAGCATCGGCAGCCGGGCCCGTGCCAGCCA
AAACGGCGGCGGGCGGGAGCCCCGCAAGAACCACGTCTATGGGGAACGCAAGCTGGGCGC
CGGCGAGGGGCTGCCCCAGGTGTGCCCGGCGCGGATGCCCCAGCAGCCCCCGCTCCACTA
CGCCAAGCCCTCGCCCTTCTTCATGGACCCCATCTACAGCAGGGTAGAAAAGCGGAAGGT
CACAGACCCCGTGGGAGCCCTGAAGGAGAAGTACCTGCGGCCGTCCCCGCTGCTCTTCCA
CCCCCAGATGTCAGCCATAGAGACCATGACAGAGAAGCTGGAGAGCTTTGCAGCCATGAA
GGCGGACTCGGGCAGCTCCCTGCAGCCCCTCCCCCACCACCCCTTCAACTTCCGGTCCCC
ACCCCCAACGCTCTCCGACCCCATCCTCAGGAAGGGCAAGGAGCGATACACGTGCAGGTA
CTGTGGGAAGATCTTCCCCAGATCAGCCAATCTCACCAGACACCTGAGGACGCACACTGG
GGAGCAGCCGTACAGGTGTAAGTACTGCGACCGCTCCTTCAGCATCTCTTCGAACCTCCA
GCGGCACGTCCGGAACATCCACAACAAGGAGAAGCCTTTCAAGTGCCACCTGTGCAACCG
CTGCTTCGGGCAGCAGACCAACCTGGACCGGCACCTCAAGAAGCACGAGCACGAGAACGC
ACCAGTGAGCCAGCACCCCGGGGTCCTCACGAACCACCTGGGGACCAGCGCGTCCTCTCC
CACCTCAGAGTCGGACAACCACGCACTTTTAGACGAGAAAGAAGACTCTTATTTCTCGGA
AATCAGAAACTTTATTGCCAATAGTGAGATGAACCAAGCATCAACGCGAACAGAGAAACG
GGCGGACATGCAGATCGTGGACGGCAGTGCCCAGTGTCCAGGCCTAGCCAGTGAGAAGCA
GGAGGACGTGGAGGAGGAGGACGACGATGACCTGGAGGAGGACGATGAGGACAGCCTGGC
CGGGAAGTCGCAGGATGACACCGTGTCCCCCGCACCCGAGCCCCAGGCCGCCTACGAGGA
TGAGGAGGATGAGGAGCCAGCCGCCTCCCTGGCCGTGGGCTTTGACCACACCCGAAGGTG
TGCTGAGGACCACGAAGGCGGTCTGTTAGCTTTGGAGCCGATGCCGACTTTTGGGAAGGG
GCTGGACCTCCGCAGAGCAGCTGAGGAAGCATTTGAAGTTAAAGATGTGCTTAATTCCAC
CTTAGATTCTGAGGCTTTAAAACATACACTGTGCAGGCAGGCTAAGAACCAGGCATATGC
AATGATGCTGTCCCTTTCCGAAGACACTCCTCTCCACACCCCCTCCCAGGGTTCTCTGGA
CGCTTGGTTGAAGGTCACTGGAGCCACGTCGGAGTCTGGAGCATTTCACCCCATCAACCA
CCTCTGACGGGCTGGGCAGCCGGGGGCCGGTGGCCAGAGCGAGGGCACCAGCCACGAAGG
ACGGAGGCGGGCGGGGCCCCGGAGAACCCTGTCCCTGCGTGTGGCCACTCCTCAGCATCC
TCCCCACCCACCATGGTTCATTCCGACTTTTCCAATGGAAACTCAGATCCCAAAAGTCCC
TAAAGCAGTCGTAGAGTCTCACCATCTCCAAGGATTGGTCTTGAGAACACTGTTCAGTGA
CGGCCATGCAGGTGGCCGTCCAAAGACAGCCAACGGAGCTGCCTCGCAGAATCAGCCAGT
GGGCAGGTGGACGCTCTGCTGAGACAGAAGCTGGTGGCCACTGCCGGGTGCCCGCGTGGG
GTCGCGGAAGGGAATGGATAGACTGGTGTGCTCAAAAGAGAGAGATCACTCAAATGATTT
TTATAATGAAATGACAAGAATAACCCTTTTGGTAACCGTATTGACTGCAGAGTCTATTTA
AGCATGTGGTTTTAAAAATAGACAGTATTTTTTAAAAATCAAAAAATGACTTGCAAATTG
TTTTTTAAAAGTAATTTTGCATTGCTTTGAAATTTGAGCTCATTTGCAAACCCGAGTCTG
CCTGGGAACCCGCACTGTGCCTGGGTGTATTCTTTATACTGTAGATAATGGAGAAATTTT
CTATCTCTGTCCCTATTTGTATAAGCCAAGGTGATGCTGGGTGCCCCGAGGCAGAACAAG
AGGCGCGGGGCCACACCCGTGAACCATGCAGACGGCCGAAGAAGTCTTAGGCAGGGCGCC
CTGGGCTGCAGGCCTGCCCGAGGCTGGGATGGGAAGTGTGCCTGCCCTCGTGTGACATGG
AATTGGTGTCAGGACCGCCACGTGGCCTTCAGAGGAATCCACAGGTCCCCACCCAAGATC
CCTCAATTATATGGGGAAGTCGAGGGCCTGTGGCTTGGATCCGCCATGCAGAGATGTGGC
CGGGCACCCATCTTCCTTCCCTCCTCTGTCCCTGCCTCGGCCACCCCACGCGGGAACCCA
GCGCCGTCCTCTGAAGGCAGGGCCTTGGCCACGTCCTGGGTCTCCCACCTCCCACCTGAC
CCCAGCGGCTCCGGTGTCCTCCACGTGGCTGCCCTGGGGAGCAATCCCAGCGGATCGCTC
CGGGCCACCAAGCCGCACCTGTGCCTGAGACTCCGGATGGACGACACAGTCGTCACGTCG
CTCTTCCTGCGGGTTCTTGGCGAGACACAGCTTGAGAACAGAAGGGCGTCGGGGGAACCT
GCCGCAAGGAGCAGAGACAGCACAGCCCCCCGGGCCCAGCCGCCTCCCTCTCTTGGGACG
CAACTTCTTCCCCACTCGGATGGGCTTTAAATTATTCCCATAGGGGCCAATTTCAAATAA
TAATTTTTTTCCCTGATGGAATTTACCTTAATCTGTATATAACTTGTAATTTTTTCTAAT
TCATTTCTTTTCTTATTTTATTTCCTCCTTAACAGTATTTTTGGCATTAGACATTCTTAT
TGTGAAGAAATAATGTTAATATAAGTATCTGGTGAAGGACCAAAACCGTGTGATAAGGTT
GTGTGTCGTGTGGGAGTGGGGCGATTTTTTATGTGCCAAATACCCCCGTCCCCCCCATGA
ATCCTGCTGTCCCTGCTGCCGTTTACCAGACAATCATATGTTTTTGTTAAATTTGCGTTT
CAGTTACATTTGCATTTAAGACAAGTGTTCTATTTATTTCTTGTATTGTTTGGAAGAAAA
AATGATGATAGAGTCCCAAAAAGAAGAGAAAAAAAATGCCCAAGTTGCCCTTTAAAAAAA
AAGAGCGTAAATACAAACAGGAGTGGTGCAAGCCGCCTTGGTGTGGGTTTGTGTCACGTG
TGGACATCTCCTCAGGCTTTGTGTCACGCGTGGACATCTCCTCAGGCTGTCCCCAGCGGT
GACGGGAGGTGTCCTGGCTGCTCCAGGACAAAAGACAATCGTCTCTGTGGGTGCCGGGTG
GTCCAGGCTTGCACTGAAGACGTGCCACGGGGAGGCTCCTGCAGGAGGCTCAACCCGACG
GATCACAGTGAAAGGGATTCCTCCCACGCCAGATCTGCACAACGAGGCAAGACAGGACCC
ACCTGTGCGTGCGCTGGGGCCATGGGGTGGCCCCGCCGGGGCAGCGGGGGAGCTGCCTGC
AGAAGAGCCAGCTGGCGTGTCGGGAAGGATCCAGGATCTGCAAACACAACTGCTCAGGCC
TTCTCACGCGTTTCCACAACATCCCCTGGGTCAGACCCACCAGGTACCCCGTAGGAATTT
CCAGTTTCCCTTGATCTAGATGGGATTCTTATAAAAATTCAACCTCAGACATAAACACCC
CATTTCTGTAAACCCAAATTATATGGTTTCTTCTGCGAAAGAGTAAGGTGTGTGCTTTTT
TTTTTTTGCAATATGACCCCGTCTCTCTGAAGTGGGACATTCGGACGGATGGAGCCCTCA
GCGTGTCTTTTCAGCAGGAGCAGAACCGATGAGAGCCGCCCTTACCGTTGGTCTCCGGAT
CCCCCAGTCCCATCCCGCCGTTTTCGGCTGTCTTCCTAACCGTCCTGTCTTCTCTTGGCG
CTCTTTCCTTCCACCTTTCCCAAGAGTCCTGGTTGCACGTTTTAAGTCATATATTTTCGT
CCCCCTGAAAATGATGGCAAGCCCAGTTTCTCCTGAGCATTCAGACCCCCAGGCCCCAGC
ACTTGGCGTTTTCAGGAGGCCCTGTTCTTAGAGCCCCTGACAAAGGCAGCACTTATTTCC
TGGGCTGGTGCGCCCCAAAACACGGCCCCGACACTTAGTGTGGCCCCAGGCCCCAGCGAG
CCTCGCCCTCCCAGTTTTGCTCTGCCCAGCAGTGTTGGTGCCCAGAGATGACAAGGGCCA
GGGAGCCTGGCCCGGGTGTGAGAATTCAGAGATTCTGGCCTCCAGCTGTCACCACACCGT
AACGGGGCCATGTAACTGTGCAGCATGGACAGGGATGCGACGGGGCAGCTGGCTGTGTCC
ATGGCCAGGTGGCCAGGGTCAGGGCTGCAAGCCAGGGGTCCAGGGCCCTTCCGTTCAGCC
CAAATGCTGCCCCAATGCTAACTCCTTGGATTGTCAACCCCCATCCCCCAAATGGAAATT
CCGAAGGAGGCCTCCTCGCACCTGCCCTCCGCTGCTCCTCAGACCCCAGCCCCCAGCGAG
CCGACGTCCCCACCCGTTCCTGCTCTCATCCCCAGGTTGGGCACGTGGGGTTCCTCCTCT
GTGGGCCTGGCAGACCCTTCATGAGTGGGACCCAAGATATCACTGACTTCAACCCAGAGG
ATCGAGCCCCTGCACCCTGCCTGGGGCCCTGGGGTGTGGAGCAGTGGCTGGGGTGGGCGT
GGTGTGGCCTGAGAGACTGCCCAGCTGGAGAGGCCTTCCTTTACAAGGCCACGCGTGCAG
CTGTCCCATCCAGACCCCGACTGGCCAAGACCTCCACGTCCCCAGAGTCCAGCCCTGGAA
ATTCCAAGGGCCCTGGCGTCCTCTGCCTTCCCCGCTTCCCCATGAGCGTCTGCAAAACAC
TTGCCTGAATACATATCACGTATTTTAGACTCGAAGCCTCAAAGCACTGGATTGTGGTCC
CCTGCCCCCTCTGTCCCGTCCCCCTGCCCAAGTGACTGAAACCTACTGAGCTATATTCAC
TGTGCTGTCCTAGGGGGAGGGAGAGCAGAGCTCGCCCCTGCACTGCAGCCTTGTGGGGGA
GGGCAAGGCTCTCCTCCCAGCCAGGGACGCCAGGACATAGCTGCTCCTGGTCAGTGGAGG
TCAGCCGGGTATCAAAAGCCATGAAACTGTGTCTCTGTAGCAATGAGTGATACTGTGACA
AAACCATCCTTGCATTCTTCCTAGAAGAGTTCCTCTGCTCCTTCCATTCCATTTTTGTGT
TTGTTTTGTTCTTTTCTGTCACTGATCCGTATTACCACTTTTGGAAAAAAATAAATAAAT
AAATAAATAAAAGGCAGCTTGAGTTTCCAAACGTGTGATTCACTTGTGAACAAAAGTCAT
TCTAACAATTGCCTTCAGCGTCACGTGCATTGCCACTGCGCTTTCGGCACGAGGGATGCT
GAGCCCTGGTGTCAGAGTCGTAATTTAAAGCGTGTGTGTATATGGACTTTGTCCCTTAAG
GTCGATATAAAGAATCCTCGCAGAATCACAGACCTGTGCCGCCCGCCACCTTCTGCCATT
GTTACATTACAGATTTGGTTTAGTTTTGTTTTGTTTTGTTTTTTCTTTTAGAACTGTATA
GTATTGAAAAAGAAATCAAATGTAAATGTCTGGTTTTCATATAATGTTTAAAAAGACCAT
TGAGAAGGAGGCTGGCGCTCGCCCCATGTCCCCCTTGATTGTAAATTGCTTCTGTTCTGT
TTATAAGTAAACTGTGCATGACTCCTGCTTAGCGGTCATTATCGTGTCTGTTGGTGAAAT
TTTTATTAAAAGGAAAATTCTGTAGATGCACTTATTGAATATGTGATTAGGATCTACGTC
TGAGACTAGGAGTCCTGAACTGCTGACGCGAAAGAGGCGCAGTTCCCAATTAATACGGAA
ATCGCTGTGGGAGAAGAATGAAATAAGACGTGAAGTGTAGGAAATCATGAAAAGAACAAT
TTTGCAAATTGCATTCTGATGCTTGTGATGAACACAAATGTACTTGTGTAGAGACATTTC
CTTAAGAGAAAGCCTAGGAGAAGCCGATTTGGAGGTTAATGCTGTAGAATAGGACTGTAT
ACCAAATGTAATCTTTCCAATGCTCCAATGAATTTATACATGAGATTGATATGCAATAAA
TCTGTGTGCTTTTCTAA

Protein Sequence

>63976 : length: 1277
MRSKARARKLAKSDGDVVNNMYEPNRDLLASHSAEDEAEDSAMSPIPVGPPSPFPTSEDF
TPKEGSPYEAPVYIPEDIPIPADFELRESSIPGAGLGVWAKRKMEAGERLGPCVVVPRAA
AKETDFGWEQILTDVEVSPQEGCITKQISEDLGSEKFCVDANQAGAGSWLKYIRVACSCD
DQNLTMCQISEQIYYKVIKDIEPGEELLVHVKEGVYPLGTVPPGLDEEPTFRCDECDELF
QSKLDLRRHKKYTCGSVGAALYEGLAEELKPEGLGGGSGQAHECKDCERMFPNKYSLEQH
MVIHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTDPSNLQRHIRSQ
HVGARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEVCHKSYTQFSNLCRHKRMHADC
RTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHYTPGGIFAPGLPLTPSPMMDKAKPSPSLN
HASLGFNEYFPSRPHPGSLPFSTAPPTFPALTPGFPGIFPPSLYPRPPLLPPTSLLKSPL
NHTQDAKLPSPLGNPALPLVSAVSNSSQGTTAAAGPEEKFESRLEDSCVEKLKTRSSDMS
DGSDFEDVNTTTGTDLDTTTGTGSDLDSDVDSDPDKDKGKGKSAEGQPKFGGGLAPPGAP
NSVAEVPVFYSQHSFFPPPDEQLLTATGAAGDSIKAIASIAEKYFGPGFMGMQEKKLGSL
PYHSAFPFQFLPNFPHSLYPFTDRALAHNLLVKAEPKSPRDALKVGGPSAECPFDLTTKP
KDVKPILPMPKGPSAPASGEEQPLDLSIGSRARASQNGGGREPRKNHVYGERKLGAGEGL
PQVCPARMPQQPPLHYAKPSPFFMDPIYSRVEKRKVTDPVGALKEKYLRPSPLLFHPQMS
AIETMTEKLESFAAMKADSGSSLQPLPHHPFNFRSPPPTLSDPILRKGKERYTCRYCGKI
FPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQ
QTNLDRHLKKHEHENAPVSQHPGVLTNHLGTSASSPTSESDNHALLDEKEDSYFSEIRNF
IANSEMNQASTRTEKRADMQIVDGSAQCPGLASEKQEDVEEEDDDDLEEDDEDSLAGKSQ
DDTVSPAPEPQAAYEDEEDEEPAASLAVGFDHTRRCAEDHEGGLLALEPMPTFGKGLDLR
RAAEEAFEVKDVLNSTLDSEALKHTLCRQAKNQAYAMMLSLSEDTPLHTPSQGSLDAWLK
VTGATSESGAFHPINHL