ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6375

Name

XCL1

Synonym

ATAC|LPTN|LTN|SCM-1|SCM-1a|SCM1|SCM1A|SCYC1;chemokine (C motif) ligand 1;XCL1;chemokine (C motif) ligand 1

Definition

SCM-1-alpha|XC chemokine ligand 1|c motif chemokine 1|cytokine SCM-1|lymphotactin|lymphotaxin|single cysteine motif 1a|small inducible cytokine subfamily C, member 1 (lymphotactin)|small-inducible cytokine C1

Position

1q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Disease

Lymphoproliferative disorder;FunDO

Disease

Lymphopenia;FunDO

Disease

Systemic scleroderma;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

IGA glomerulonephritis;FunDO

External Links

Links to cell senescence gene database

6375

Links to epithelial mesenchymal transition gene database

6375

Links to ovarian cancer gene database

6375

Links to endometrial cancer gene database

6375

Links to iHOP

6375

Sequence Information

Nucleotide Sequence

>6375 : length: 1367
TAAGAAAAATAAAAGCATCAGTATTGCAAAGACTTTCCATGATCCTACACCCACCTCGAA
AGCCCCCTCTCACCACAGGAAGTGCACTGACCACTGGAGGCATAAAAGAGGTCCTCAAAG
AGCCCGATCCTCACTCTCCTTGCACAGCTCAGCAGGACCTCAGCCATGAGACTTCTCATC
CTGGCCCTCCTTGGCATCTGCTCTCTCACTGCATACATTGTGGAAGGTGTAGGGAGTGAA
GTCTCAGATAAGAGGACCTGTGTGAGCCTCACTACCCAGCGACTGCCGGTTAGCAGAATC
AAGACCTACACCATCACGGAAGGCTCCTTGAGAGCAGTAATTTTTATTACCAAACGTGGC
CTAAAAGTCTGTGCTGATCCACAAGCCACATGGGTGAGAGACGTGGTCAGGAGCATGGAC
AGGAAATCCAACACCAGAAATAACATGATCCAGACCAAGCCAACAGGAACCCAGCAATCG
ACCAATACAGCTGTGACTCTGACTGGCTAGTAGTCTCTGGCACCCTGTCCGTCTCCAGCC
AGCCAGCTCATTTCACTTTACACGCTCATGGACTGAGTTTATACTCACCTTTTATGAAAG
CACTGCATGAATAAAATTATTCCTTTGTATTTTTACTTTTAAATGTCTTCTGTATTCACT
TATATGTTCTAATTAATAAATTATTTATTATTAAGAATAGTTCCCTAGTCTATTCATTAT
ATTTAGGGAAAGGTAGTGTATCATTGTTGTTTGATTTCTGACCTTGTACCTCTCTTTGAT
GGTAACCATAATGGAAGAGATTCTGGCTAGTGTCTATCAGAGGTGAAAGCTATATCAATC
TCTCTTAGAGTCCAGCTTGTAATGGTTCTTTACACATCAGTCACAAGTTACAGCTGTGAC
AATGGCAACAATTTGAGATGTATTTCAACTTGTCTCTATAATAGAATTCTGTTTATAGAA
TAAGGGAGAAAATAATCCAGTCTTCACTGGGTTCCCATTCTGAGGGTCCACTACTCAAAA
ATTTGCTTCACTCAATTTTTTTCACCTCTTTGTGTTTTATTTTGGTGTCCTATTAAAGGA
ATAAAATGACACAACTTGTCCCTTTTTTGTCCCATTAGCAAAAATTAGAATTTTGGTATA
AAGAAACTTTATTCAAGTAAAAATCAATACCCTTTGAATTGGACAATAATCTCACTACCT
TATTAGGATTTCTGTATTTGCCATTACGCTAGTTATCATGCATGTTATGCTTTACTGCGA
ATAAGCTTTTAATGCTCCAAATGCTGACCCATGCAATATTTCCTCATGTGATCACAATTT
GCAGTAAACTTTTAATTAAATGCTCATCTGGTAACTCAACACCCCAG

Protein Sequence

>6375 : length: 114
MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIF
ITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG