ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6304

Name

SATB1

Synonym

SATB homeobox 1;SATB1;SATB homeobox 1

Definition

DNA-binding protein SATB1|special AT-rich sequence binding protein 1 (binds to nuclear matrix/scaffold-associating DNA)|special AT-rich sequence-binding protein 1

Position

3p23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Apoptosis;Reactome;REACT:578

Pathway

Caspase cascade in apoptosis;PID Curated;200148

Pathway

Apoptotic cleavage of cellular proteins;PID Reactome;500270

Disease

Leukoencephalopathy;FunDO

Disease

Neoplasm metastasis;FunDO

External Links

Links to cell senescence gene database

6304

Links to epithelial mesenchymal transition gene database

6304

Links to ovarian cancer gene database

6304

Links to endometrial cancer gene database

6304

Links to iHOP

6304

Sequence Information

Nucleotide Sequence

>6304 : length: 6041
CTTCCCTTGGCCCCGCGCGCTCGCTCGCTCGCTCCTCGCCTCGCTCTCCCCTTTAAACGC
CCACTTCGTATGGGGAAAGAGGACAACTTGAAGTCAAGTTGCAATTAACTTCCGCGGCAG
CCGCAGCTCCGGCGGCGGCGGCGGCGGCAGGAGAGGCAGAAGCCGCCGCCTCGGAAGTCC
GACGCCGGCGCGCCCGCCCGGGGAGCCGTTCTTGGTTTCAGGCCCGCACTCGACAGCCAC
CGCCGCCCCCAACGTCCATGCCTGAGTGATCTTTAGACAGTGACTGAGTATGGATCATTT
GAACGAGGCAACTCAGGGGAAAGAACATTCAGAAATGTCTAACAATGTGAGTGATCCGAA
GGGTCCACCAGCCAAGATTGCCCGCCTGGAGCAGAACGGGAGCCCGCTAGGAAGAGGAAG
GCTTGGGAGTACAGGTGCAAAAATGCAGGGAGTGCCTTTAAAACACTCGGGCCATCTGAT
GAAAACCAACCTTAGGAAAGGAACCATGCTGCCAGTTTTCTGTGTGGTGGAACATTATGA
AAACGCCATTGAATATGATTGCAAGGAGGAGCATGCAGAATTTGTGCTGGTGAGAAAGGA
TATGCTTTTCAACCAGCTGATCGAAATGGCATTGCTGTCTCTAGGTTATTCACATAGCTC
TGCTGCCCAGGCCAAAGGGCTAATCCAGGTTGGAAAGTGGAATCCAGTTCCACTGTCTTA
CGTGACAGATGCCCCTGATGCTACAGTAGCAGATATGCTTCAAGATGTGTATCATGTGGT
CACATTGAAAATTCAGTTACACAGTTGCCCCAAACTAGAAGACTTGCCTCCCGAACAATG
GTCGCACACCACAGTGAGGAATGCTCTGAAGGACTTACTGAAAGATATGAATCAGAGTTC
ATTGGCCAAGGAGTGCCCCCTTTCACAGAGTATGATTTCTTCCATTGTGAACAGTACTTA
CTATGCAAATGTCTCAGCAGCAAAATGTCAAGAATTTGGAAGGTGGTACAAACATTTCAA
GAAGACAAAAGATATGATGGTTGAAATGGATAGTCTTTCTGAGCTATCCCAGCAAGGCGC
CAATCATGTCAATTTTGGCCAGCAACCAGTTCCAGGGAACACAGCCGAGCAGCCTCCATC
CCCTGCGCAGCTCTCCCATGGCAGCCAGCCCTCTGTCCGGACACCTCTTCCAAACCTGCA
CCCTGGGCTCGTATCAACACCTATCAGTCCTCAATTGGTCAACCAGCAGCTGGTGATGGC
TCAGCTGCTGAACCAGCAGTATGCAGTGAATAGACTTTTAGCCCAGCAGTCCTTAAACCA
ACAATACTTGAACCACCCTCCCCCTGTCAGTAGATCTATGAATAAGCCTTTGGAGCAACA
GGTTTCGACCAACACAGAGGTGTCTTCCGAAATCTACCAGTGGGTACGCGATGAACTGAA
ACGAGCAGGAATCTCCCAGGCGGTATTTGCACGTGTGGCTTTTAACAGAACTCAGGGCTT
GCTTTCAGAAATCCTCCGAAAGGAAGAGGACCCCAAGACTGCATCCCAGTCTTTGCTGGT
AAACCTTCGGGCTATGCAGAATTTCTTGCAGTTACCGGAAGCTGAAAGAGACCGAATATA
CCAGGACGAAAGGGAAAGGAGCTTGAATGCTGCCTCGGCCATGGGTCCTGCCCCCCTCAT
CAGCACACCACCCAGCCGTCCTCCCCAGGTGAAAACAGCTACTATTGCCACTGAAAGGAA
TGGGAAACCAGAGAACAATACCATGAACATTAATGCTTCCATTTATGATGAGATTCAGCA
GGAAATGAAGCGTGCTAAAGTGTCTCAAGCACTGTTTGCAAAGGTTGCAGCAACCAAAAG
CCAGGGATGGTTGTGCGAGCTGTTACGCTGGAAAGAAGATCCTTCTCCAGAAAACAGAAC
CCTGTGGGAGAACCTCTCCATGATCCGAAGGTTCCTCAGTCTTCCTCAGCCAGAACGTGA
TGCCATTTATGAACAGGAGAGCAACGCGGTGCATCACCATGGCGACAGGCCGCCCCACAT
TATCCATGTTCCAGCAGAGCAGATTCAGAGCCCCTCTCCCACCACCCTTGGGAAAGGAGA
GTCTAGAGGCGTTTTCTTACCAGGCCTGCCGACCCCTGCACCATGGCTCGGTGCTGCTCC
TCAGCAACAGCAGCAGCAACAGCAACAGCAGCAGCAGCAGCAGCAGGCACCGCCGCCTCC
ACAGCCACAGCAGCAGCCACAGACAGGCCCTCGGCTCCCCCCACGGCAACCCACGGTGGC
CTCTCCAGCAGAGTCAGATGAGGAAAACCGACAGAAGACCCGGCCACGAACAAAAATTTC
AGTGGAAGCCTTGGGAATCCTCCAGAGTTTCATACAAGACGTGGGCCTGTACCCTGACGA
AGAGGCCATCCAGACTCTGTCTGCCCAGCTCGACCTTCCCAAGTACACCATCATCAAGTT
CTTTCAGAACCAGCGGTACTATCTCAAGCACCACGGCAAACTGAAGGACAATTCCGGTTT
AGAGGTCGATGTGGCAGAATATAAAGAAGAGGAGCTGCTGAAGGATTTGGAAGAGAGTGT
CCAAGATAAAAATACTAACACCCTTTTTTCAGTGAAACTAGAAGAAGAGCTGTCAGTGGA
AGGAAACACAGACATTAATACTGATTTGAAAGACTGAGATAAAAGTATTTGTTTCGTTCA
ACAGTGCCACTGGTATTTACTAACAAAATGAAAAGTCCACCTTGTCTTCTCTCAGAAAAC
CTTTGTTGTTCATTGTTTGGCCAATGAATCTTCAAAAACTTGCACAAACAGAAAAGTTGG
AAAAGGATAATACAGACTGCACTAAATGTTTTCCTCTGTTTTACAAACTGCTTGGCAGCC
CCAGGTGAAGCATCAAGGATTGTTTGGTATTAAAATTTGTGTTCACGGGATGCACCAAAG
TGTGTACCCCGTAAGCATGAAACCAGTGTTTTTTGTTTTTTTTTTAGTTCTTATTCCGGA
GCCTCAAACAAGCATTATACCTTCTGTGATTATGATTTCCTCTCCTATAATTATTTCTGT
AGCACTCCACACTGATCTTTGGAAACTTGCCCCTTATTTAAAAAAAAAAAAGAAAAAAAA
GAGTTTGTTACTCTATTGTATGTTACAAAAGAACTATAGACTGTGGAATGCAGTTTAAAG
ATGACATATGCCAACAAATGCCTTGTATTATATGGCACTGCCGTAATTCAAATTTGTTTT
TATTTTGGAAATAAAAGTTCACTGTACTTTTTTTTCATTCTCATTGTTACATGATTTTTT
AAAAAAAGGAAAAGAAAATGTGAAACACAATTTAGTCCTCATTATTTATTTGTAGATCCT
GCAGCATCATGTTGTAATTAATTTTTTGGAAGTTTCCGTTAAATGTAATATTGCTTCTCT
TGTTACCATACTGATTCTTTTCTATTTATAAATGTATTTTGATGGGCAGTAAAACAAAGT
GTCTTAAAAGTTTTAAATAGAGAAAATGTGCTTTACACAGTTGCCTATAAAAAGTGCTCT
ATGTTATCCAAGCAATTCATACTATAAGCTTCACTCTTATTGTTGTATGCAATTTTTACT
ATCATGCAAATAAGCTTAGGTAAATAAAACTAATAGATCACCTTAGAAAATTATGCAATT
AATGTGAAAATAATTGATGTTTGCAATGTGTCTTCCTTTGGTTTACAATCAATTTTAAAG
CTACATCTGTATAAAATTTCTGTATAAAGGTGTATTTCTTTTTTATGAGTTTATGGCTAT
GAAAACAGCTATTTTGTTACAGCTGGCTGTTTTTATAAGTGTATCACAATTTTCTTTATG
CAGAAATGTTCTGACTAGGAGTGGTTATTGACTGTAACTACACAATTAAAATTGTTTGTA
TCGTATGACATGGTAGGGTTTGTCTGCTTATGTGAAGTAACTAAAGGAGTCAAAGGATGG
CCCTCTCATTTAGGTGCATGTTAATAACTTGTTATTTCACTGATTTTAAAAAGAGCAATT
GACAAGTTACTTGAAACACTGTAAATTTAAATCACAAACACATGCTCATTTTTAAATAGG
TATGAAATTTCACAATGAAAATAACCTGTTTGGTTAACATTTTGCTTAATAAGTAGAGAT
AGGATGGTCAAAAGACTCTCCGACAAAAACAAATCCAGTCTCTAGCAGTTATGTTGTTAG
AATGGATTCATCTGTGCTTATTTCACAATACTTCATTTATAGCAATGCTTTTCCTTAAGC
TAATGTATAAATATTTCTAAAGGCCATTAATAGTAACAAAATAAGTAGGGGAAAAAATGG
ACCTTCTGTATAAAAACCCCTTAGCTTTTTTTTTTCACAAGTTATAAGTGGAATAAGTTA
ATAACTGAGCTCGTAAGTGTATCTCATAACTATAAGAGCTACATGAAGAAAATAGGAATA
ACACACCTGGTATTTAAACACAATCTTCAAAATTCTTGCAACATTAAACATAGTAAAATG
CCAGAATATAAAATGAGGTGTGCTAATGGTCACAGGATTGAGGCCAGCATTACAGTTTGG
GGTGATTTTTCTTTTATTTGCTCCCTCACTTTGTTTCCTAGATGCTAGTAGGGGTATCTG
GGTTGCTTGAGATACCATTTTGCAATTGCCCCTTCTCTTTCTGCCTACCATCTTCTCAGG
CCCTGATGAGCTTATTGGTAGGCAACTGGGCTGCTTTAGTGTTGAACTTGTACTTTAGAA
ACTGAAGTGGAATCATTGAAAACTTTCAATAAAGCTTTAAAGTTCCATTTACTTTTGAAG
CACAGCTAAGCTCCTCTGAAGGCAGCTGGTTTGTTGCAAACTTAAAATTGTACTGAAAAG
TTGCCACTTTTTATTTAGTAAGAAAACAAACATTCTGGCTCACTAGAGTTCAGAAAAGTA
ATAATTTGAGCCAAAGGAATTTGAATTAAGAAAATAGAAACTAGGTTTCATGTATTTAAA
AAATAGGAAATAAAATAGAAACTCAAATGCCATGAAGTTATCTTCCTCTTCCTTATATCC
CCTAAGTTTGGGTTGCAAATAACTTTCCAATTCCTAATAACCTAAATTATTTTGAAATAG
TGTTTTCAGTGAAATGATGAATGTTTGAATGTTTGTTTGGTAATCAACATAACAATGCTA
ACAAAATTCCCACTTAGATTTTTTAACTTTTAAAAGTCAGCGTGGTTTTGATAATTTGAT
ATTTTAAATGCCCACACATACACACACACACACACACACACACACACAAGCACATGTTAA
TAAACTGATAGGATGGAGTGAGCAAAATTGTTTTCAGGGAAGATGGCACATTTTAGAAAA
GACTTGCCCAGATGATCTTCCATATTGCTCCCCCAATGTCATTTATCGCTCATGCCAATC
CTCCTCTTGTTACCTGTGGCTATGGTAAAATTCCTTTAACAAGCTTCATTGTGTCCAAGT
ATTTCAGAGACTTTTAAAAGCTGGGCATGACATAGCGTTTTGTGCTGTTAAGACCTTAGC
AGAGTCAGGTAGTTTACGGGTAATATTCAACCTTGTGCATCTGAATCTGTCATGGATTCC
CTTCACTCAGCACTTTGCCACTAATTTGTATTACACTCTGTGGCCATATAATACTTGCAC
ATTATGCAAAAAAAAATGTTGATAGTATCTCCTTGCCACACAATATGCAGAGTTGACAAC
CTTTGAAAACCAAGGTAACTAATATGTATGTCCTAGTTGTGTGGCGCTTGGTAACAAAGT
CTGTACATATTATGTATAAAATGTGTATTGGTTAGCATTTAGTACTAAGAAATTCTGAGT
TTAAAATAAGTGATTTTTTTCAAAGTAGCGATATCTATATCTGTGTTTATCTAAAAATAC
TGGCTTGAATAGAAAACATTCTCAGATGATTCAAGATTGAGTAAAAATGAGAATCCCATA
CATTCCATTATTAAATTCTGCCCTATTCCCAATTGTTAGCATCTGGCTGATATTAAGGTC
TTTGATTGTCACAATATTCTCAATAAATGAGACATTCTGAA

Protein Sequence

>6304 : length: 795
MDHLNEATQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGAKMQGVPLKHS
GHLMKTNLRKGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGY
SHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLP
PEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWY
KHFKKTKDMMVEMDSLSELSQQGANHVNFGQQPVPGNTAEQPPSPAQLSHGSQPSVRTPL
PNLHPGLVSTPISPQLVNQQLVMAQLLNQQYAVNRLLAQQSLNQQYLNHPPPVSRSMNKP
LEQQVSTNTEVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQ
SLLVNLRAMQNFLQLPEAERDRIYQDERERSLNAASAMGPAPLISTPPSRPPQVKTATIA
TERNGKPENNTMNINASIYDEIQQEMKRAKVSQALFAKVAATKSQGWLCELLRWKEDPSP
ENRTLWENLSMIRRFLSLPQPERDAIYEQESNAVHHHGDRPPHIIHVPAEQIQSPSPTTL
GKGESRGVFLPGLPTPAPWLGAAPQQQQQQQQQQQQQQQAPPPPQPQQQPQTGPRLPPRQ
PTVASPAESDEENRQKTRPRTKISVEALGILQSFIQDVGLYPDEEAIQTLSAQLDLPKYT
IIKFFQNQRYYLKHHGKLKDNSGLEVDVAEYKEEELLKDLEESVQDKNTNTLFSVKLEEE
LSVEGNTDINTDLKD