ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6295

Name

SAG

Synonym

RP47|S-AG;S-antigen; retina and pineal gland (arrestin);SAG;S-antigen; retina and pineal gland (arrestin)

Definition

48 kDa protein|S-arrestin|arrestin 1|retinal S-antigen (48 KDa protein)|rod photoreceptor arrestin

Position

2q37.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Heterotrimeric G-protein signaling pathway-rod outer segment phototransduction;PANTHER;P00028

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Visual signal transduction: Rods;PID Curated;200139

Disease

Retinitis pigmentosa;FunDO

Disease

Retinal disease;FunDO

Disease

Behcet syndrome;FunDO

Disease

Eye disease;FunDO

Disease

Retinitis pigmentosa-47;OMIM

Disease

Oguchi disease-1;OMIM

Disease

Serum calcium;NHGRI

External Links

Links to cell senescence gene database

6295

Links to epithelial mesenchymal transition gene database

6295

Links to ovarian cancer gene database

6295

Links to endometrial cancer gene database

6295

Links to iHOP

6295

Sequence Information

Nucleotide Sequence

>6295 : length: 1777
ATGTGCCACTGGAATACGTCAGCTATGGGGCCATCAGCATTGAGGGGGCATGGCTGAAAT
GGGGCCCCAAACGGCCCCCTCTGTCCTCTCCACCTTCCTCCTGGGTGCCCTGCTCCTCTC
TGGACCAGGAGGCATCTGGTTTGAGCCCCGAAAGCCCAAGTCCTTGACCAGAGAAGGGCG
CCTGTTCTCAGGGAAAGCCACTGCACAGGACAGCTGTCAAACCACGTGGTCTCTGGGCAC
CTTCTTAGTCCTGAGCTTGAATGAGGGGCGAGTGAGTGGCCACTGTTTCTTCTGAGTCAG
CAGCGAAGGGCAGTTACCTTTGGGGCTTGCAGGCAAAATTCTCAACCAACAGCTACCACG
CACTTGGCGGGGCCGCCTCTCGTGCTTTATATTTGAGAAATATGTGCTTCGTGTCTTTTT
TAGAAGGTGTAGTGAACTTCATACAATTCTTCTGGTCTACTGGGCGCACACTTCAGTGTA
TGTCACTCTGACCTGCGCCTTCCGCTATGGCCAAGAGGACATTGACGTGATCGGCTTGAC
CTTCCGCAGGGACCTGTACTTCTCCCGGGTCCAGGTGTATCCTCCTGTGGGGGCCGCGAG
CACCCCCACAAAACTGCAAGAGAGCCTGCTTAAAAAGCTGGGGAGCAACACGTACCCCTT
TCTCCTGACGTTTCCTGACTACTTGCCCTGTTCAGTGATGTTGCAGCCAGCTCCACAAGA
TTCAGGGAAGTCCTGTGGGGTTGACTTTGAGGTCAAAGCATTCGCCACAGACAGCACCGA
TGCCGAAGAGGACAAAATCCCCAAGAAGAGCTCCGTGCGATTACTGATCCGCAAAGTACA
GCATGCCCCACTTGAGATGGGTCCCCAGCCCCGAGCTGAGGCGGCCTGGCAGTTCTTCAT
GTCTGACAAGCCCCTGCACCTTGCGGTCTCTCTCAACAAAGAGATCTATTTCCATGGGGA
GCCCATCCCTGTGACCGTGACTGTCACCAATAACACAGAGAAGACCGTGAAGAAGATTAA
AGCATTCGTGGAACAGGTGGCCAATGTGGTTCTCTACTCGAGTGATTATTACGTCAAGCC
CGTGGCTATGGAGGAAGCGCAAGAAAAAGTGCCACCAAACAGCACTTTGACCAAGACGCT
GACGCTGCTGCCCTTGCTGGCTAACAATCGAGAAAGGAGAGGCATTGCCCTGGATGGGAA
AATCAAGCACGAGGACACAAACCTTGCCTCCAGCACCATCATTAAGGAGGGCATAGACCG
GACCGTCCTGGGAATCCTGGTGTCTTACCAGATCAAGGTGAAGCTCACAGTGTCAGGCTT
TCTGGGAGAGCTCACCTCCAGTGAAGTCGCCACTGAGGTCCCATTCCGCCTCATGCACCC
TCAGCCTGAGGACCCAGGTAAATGAAGCAGCAAAAATAATATAGGTGAAATCTCAGAAAT
TCTGAAGAAACATTCTCTGCATCGAGGCAGCTTAGTTGACGGGAAAGAAAAACAGATCTG
TCTAAATGAGAACTCTCCCTAAGGAAAGTTATCAGGATGCAAATTTAGTTTTTGAGGAGT
TTGCTCGCCATAATCTGAAAGATGCAGGAGAAGCTGAGGAGGGGAAGAGAGACAAGAATG
ACGTTGATGAGTGAAGATGTCGGCTCAGGATGCCGGAAAATGACCTGTAGTTACCAGTGC
AACGAGCAAAGCCCCACAGTTTAGTCCTTTGGAGTTATGCTGCGTATGAAAGGATGAGTC
TTCTTCCGAGAAATAAAGCTTGTTTGTTCTCCCCTGG

Protein Sequence

>6295 : length: 405
MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKK
VYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTY
PFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRK
VQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKK
IKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALD
GKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLM
HPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE