ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6279

Name

S100A8

Synonym

60B8AG|CAGA|CFAG|CGLA|CP-10|L1Ag|MA387|MIF|MRP8|NIF|P8;S100 calcium binding protein A8;S100A8;S100 calcium binding protein A8

Definition

MRP-8|S100 calcium-binding protein A8 (calgranulin A)|calgranulin A|calgranulin-A|calprotectin L1L subunit|cystic fibrosis antigen|leukocyte L1 complex light chain|migration inhibitory factor-related protein 8|protein S100-A8|urinary stone protein band A

Position

1q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endogenous TLR signaling;PID Curated;200177

Disease

Autoimmune disease;FunDO

Disease

Herpes;FunDO

Disease

Psoriasis;FunDO

Disease

Prostate cancer;FunDO

Disease

Polymyositis;FunDO

Disease

Fetal disease;FunDO

Disease

Periodontitis;FunDO

Disease

Labor, Premature;FunDO

Disease

Kidney failure;FunDO

Disease

Eating disorder;FunDO

Disease

Breast cancer;FunDO

Disease

Endometrial cancer;FunDO

Disease

Esophagus cancer;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to cell senescence gene database

6279

Links to epithelial mesenchymal transition gene database

6279

Links to ovarian cancer gene database

6279

Links to endometrial cancer gene database

6279

Links to iHOP

6279

Sequence Information

Nucleotide Sequence

>6279 : length: 532
GAGAAACCAGAGACTGTAGCAACTCTGGCAGGGAGAAGCTGTCTCTGATGGCCTGAAGCT
GTGGGCAGCTGGCCAAGCCTAACCGCTATAAAAAGGAGCTGCCTCTCAGCCCTGCATGTC
TCTTGTCAGCTGTCTTTCAGAAGACCTGGTGGGGCAAGTCCGTGGGCATCATGTTGACCG
AGCTGGAGAAAGCCTTGAACTCTATCATCGACGTCTACCACAAGTACTCCCTGATAAAGG
GGAATTTCCATGCCGTCTACAGGGATGACCTGAAGAAATTGCTAGAGACCGAGTGTCCTC
AGTATATCAGGAAAAAGGGTGCAGACGTCTGGTTCAAAGAGTTGGATATCAACACTGATG
GTGCAGTTAACTTCCAGGAGTTCCTCATTCTGGTGATAAAGATGGGCGTGGCAGCCCACA
AAAAAAGCCATGAAGAAAGCCACAAAGAGTAGCTGAGTTACTGGGCCCAGAGGCTGGGCC
CCTGGACATGTACCTGCAGAATAATAAAGTCATCAATACCTCAAAAAAAAAA

Protein Sequence

>6279 : length: 101
MWGKSVGIMLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGAD
VWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE