ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6278

Name

S100A7

Synonym

PSOR1|S100A7c;S100 calcium binding protein A7;S100A7;S100 calcium binding protein A7

Definition

S100 calcium-binding protein A7 (psoriasin 1)|protein S100-A7|psoriasin 1

Position

1q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Disease

Squamous cell cancer;FunDO

Disease

Skin tumor;FunDO

Disease

Skin cancer;FunDO

Disease

Atopic rhinitis;FunDO

Disease

Breast cancer;FunDO

Disease

Acne;FunDO

External Links

Links to cell senescence gene database

6278

Links to epithelial mesenchymal transition gene database

6278

Links to ovarian cancer gene database

6278

Links to endometrial cancer gene database

6278

Links to iHOP

6278

Sequence Information

Nucleotide Sequence

>6278 : length: 450
GTCCAAACACACACATCTCACTCATCCTTCTACTCGTGACGCTTCCCAGCTCTGGCTTTT
TGAAAGCAAAGATGAGCAACACTCAAGCTGAGAGGTCCATAATAGGCATGATCGACATGT
TTCACAAATACACCAGACGTGATGACAAGATTGAGAAGCCAAGCCTGCTGACGATGATGA
AGGAGAACTTCCCCAACTTCCTTAGTGCCTGTGACAAAAAGGGCACAAATTACCTCGCCG
ATGTCTTTGAGAAAAAGGACAAGAATGAGGATAAGAAGATTGATTTTTCTGAGTTTCTGT
CCTTGCTGGGAGACATAGCCACAGACTACCACAAGCAGAGCCATGGAGCAGCGCCCTGTT
CCGGGGGCAGCCAGTGACCCAGCCCCACCAATGGGCCTCCAGAGACCCCAGGAACAATAA
AATGTCTTCTCCCACCAGAAAAAAAAAAAA

Protein Sequence

>6278 : length: 101
MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFE
KKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ