ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6275

Name

S100A4

Synonym

18A2|42A|CAPL|FSP1|MTS1|P9KA|PEL98;S100 calcium binding protein A4;S100A4;S100 calcium binding protein A4

Definition

S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)|fibroblast-specific protein-1|leukemia multidrug resistance associated protein|malignant transformation suppression 1|placental calcium-binding protein|pr

Position

1q21

Gene Type

protein-coding

External Links

Links to cell senescence gene database

6275

Links to epithelial mesenchymal transition gene database

6275

Links to ovarian cancer gene database

6275

Links to endometrial cancer gene database

6275

Links to iHOP

6275

Sequence Information

Nucleotide Sequence

>6275 : length: 564
ATTCTTCCCCTCTCTACAACCCTCTCTCCTCAGCGCTTCTTCTTTCTTGGTTTGGTGCTT
CTGAGATGTGGGCTTGCACACGCTGTTGCTATAGTACGTGTTGATCCTGACTGCTGTCAT
GGCGTGCCCTCTGGAGAAGGCCCTGGATGTGATGGTGTCCACCTTCCACAAGTACTCGGG
CAAAGAGGGTGACAAGTTCAAGCTCAACAAGTCAGAACTAAAGGAGCTGCTGACCCGGGA
GCTGCCCAGCTTCTTGGGGAAAAGGACAGATGAAGCTGCTTTCCAGAAGCTGATGAGCAA
CTTGGACAGCAACAGGGACAACGAGGTGGACTTCCAAGAGTACTGTGTCTTCCTGTCCTG
CATCGCCATGATGTGTAACGAATTCTTTGAAGGCTTCCCAGATAAGCAGCCCAGGAAGAA
ATGAAAACTCCTCTGATGTGGTTGGGGGGTCTGCCAGCTGGGGCCCTCCCTGTCGCCAGT
GGGCACTTTTTTTTTTCCACCCTGGCTCCTTCAGACACGTGCTTGATGCTGAGCAAGTTC
AATAAAGATTCTTGGAAGTTTTGA

Protein Sequence

>6275 : length: 101
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMS
NLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK