ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6237

Name

RRAS

Synonym

related RAS viral (r-ras) oncogene homolog;RRAS;related RAS viral (r-ras) oncogene homolog

Definition

Oncogene RRAS|p23|ras-related protein R-Ras

Position

19q13.33

Gene Type

protein-coding

Pathways and Diseases

Pathway

Sema4D mediated inhibition of cell attachment and migration;PID Reactome;500073

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion;PID Reactome;500075

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

EPHB forward signaling;PID Curated;200041

Disease

Breast cancer;FunDO

External Links

Links to cell senescence gene database

6237

Links to epithelial mesenchymal transition gene database

6237

Links to ovarian cancer gene database

6237

Links to endometrial cancer gene database

6237

Links to iHOP

6237

Sequence Information

Nucleotide Sequence

>6237 : length: 1013
GGCTCCCCCGCAGGCGGTAGCGAAGGCAGCAGCAGCGGTGGCGACATGAGCAGCGGGGCG
GCGTCCGGGACAGGGCGGGGGCGGCCCCGGGGCGGGGGACCTGGGCCCGGGGACCCCCCG
CCCAGCGAGACACACAAGCTGGTGGTCGTGGGCGGCGGCGGCGTGGGCAAGAGCGCGCTG
ACCATCCAGTTCATCCAGTCCTACTTCGTGTCTGACTACGACCCCACTATTGAGGACTCC
TACACGAAGATCTGCAGTGTGGATGGCATCCCAGCCCGGCTGGACATCCTGGACACCGCG
GGCCAGGAAGAGTTCGGGGCCATGAGAGAGCAGTACATGCGTGCTGGCCACGGCTTCCTG
CTGGTGTTCGCCATTAACGACCGGCAGAGTTTCAACGAGGTGGGCAAGCTCTTCACGCAG
ATTCTGCGGGTCAAGGACCGCGACGACTTCCCCGTTGTGTTGGTCGGGAACAAGGCAGAT
CTGGAGTCACAGCGCCAGGTCCCCCGATCAGAAGCCTCTGCCTTCGGCGCCTCCCACCAC
GTGGCCTACTTTGAGGCCTCGGCCAAACTGCGTCTCAACGTGGACGAGGCTTTTGAGCAG
CTGGTGCGGGCTGTCCGGAAATACCAGGAACAAGAGCTCCCACCGAGCCCTCCCAGTGCC
CCCAGGAAGAAGGGCGGGGGCTGCCCCTGCGTCCTCCTGTAGCCCAGGCAAGAGAGAAGC
AACCACCACAAGCTCTCGGGACTAGCTGCCTTCGCACCTTGCTGTGTGACCTGAGGCCCT
CACTGAGCCTCAATTTCCTCATCTGGGTCTCCCAGGACACATCACATACCCACCCTTACT
TCCTGGCCTCTTCTGGGCTACTGCCACTGTGTGCCTTCTGCCAACGCCTCCTGTCCCCAC
CTAAGCCTGGTGGGGGTGAGGGGCTCCGGGTCACTGCTGTATATAACTCCCCTCCCCCAG
AAAAATAAATGTCACTGCCAACGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>6237 : length: 218
MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP
TIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG
KLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVD
EAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL