ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

613

Name

BCR

Synonym

ALL|BCR1|CML|D22S11|D22S662|PHL;breakpoint cluster region;BCR;breakpoint cluster region

Definition

BCR/FGFR1 chimera protein|FGFR1/BCR chimera protein|breakpoint cluster region protein|renal carcinoma antigen NY-REN-26

Position

22q11.23

Gene Type

protein-coding

Pathways and Diseases

Pathway

ctcf: first multivalent nuclear factor;PID BioCarta;100194

Pathway

Regulation of RhoA activity;PID Curated;200050

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

integrin signaling pathway;PID BioCarta;100123

Pathway

Signaling by Rho GTPases;Reactome;REACT:11044

Pathway

Regulation of RAC1 activity;PID Curated;200165

Pathway

bcr signaling pathway;PID BioCarta;100227

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

inhibition of cellular proliferation by gleevec;PID BioCarta;100154

Disease

DEVELOPMENTAL;GAD

Disease

Cancers;KEGG DISEASE

Disease

Myeloproliferative disease;FunDO

Disease

Height;NHGRI

Disease

Leukemia, chronic myeloid;OMIM

Disease

depressive disorder, major;GAD

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

CANCER;GAD

Disease

Leukemia, acute lymphocytic;OMIM

Disease

PSYCH;GAD

Disease

thyroid cancer;GAD

Disease

Congenital abnormality;FunDO

Disease

Cerebrovascular disorder;FunDO

Disease

Cancer;FunDO

Disease

Chronic myeloid leukemia (CML);KEGG DISEASE;H00004

Disease

melanoma;GAD

Disease

Bone marrow disease;FunDO

Disease

bipolar disorder;GAD

Disease

Acute lymphoblastic leukemia (ALL) (Precursor B lymphoblastic leukemia);KEGG DISEASE;H00001

Disease

height;GAD

Disease

colorectal cancer;GAD

External Links

Links to cell senescence gene database

613

Links to epithelial mesenchymal transition gene database

613

Links to ovarian cancer gene database

613

Links to endometrial cancer gene database

613

Links to iHOP

613

Sequence Information

Nucleotide Sequence

>613 : length: 6927
GGGGGGAGGGTGGCGGCTCGATGGGGGAGCCGCCTCCAGGGGGCCCCCCCGCCCTGTGCC
CACGGCGCGGCCCCTTTAAGAGGCCCGCCTGGCTCCGTCATCCGCGCCGCGGCCACCTCC
CCCCGGCCCTCCCCTTCCTGCGGCGCAGAGTGCGGGCCGGGCGGGAGTGCGGCGAGAGCC
GGCTGGCTGAGCTTAGCGTCCGAGGAGGCGGCGGCGGCGGCGGCGGCACGGCGGCGGCGG
GGCTGTGGGGCGGTGCGGAAGCGAGAGGCGAGGAGCGCGCGGGCCGTGGCCAGAGTCTGG
CGGCGGCCTGGCGGAGCGGAGAGCAGCGCCCGCGCCTCGCCGTGCGGAGGAGCCCCGCAC
ACAATAGCGGCGCGCGCAGCCCGCGCCCTTCCCCCCGGCGCGCCCCGCCCCGCGCGCCGA
GCGCCCCGCTCCGCCTCACCTGCCACCAGGGAGTGGGCGGGCATTGTTCGCCGCCGCCGC
CGCCGCGCGGGCCATGGGGGCCGCCCGGCGCCCGGGGCCGGGCTGGCGAGGCGCCGCGCC
GCCGCTGAGACGGGCCCCGCGCGCAGCCCGGCGGCGCAGGTAAGGCCGGCCGCGCCATGG
TGGACCCGGTGGGCTTCGCGGAGGCGTGGAAGGCGCAGTTCCCGGACTCAGAGCCCCCGC
GCATGGAGCTGCGCTCAGTGGGCGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCA
TTCGGCGCCTGGAGCAGGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAGACGT
TGCTGGCCAAGGAAAAGAAGAGCTATGACCGGCAGCGATGGGGCTTCCGGCGCGCGGCGC
AGGCCCCCGACGGCGCCTCCGAGCCCCGAGCGTCCGCGTCGCGCCCGCAGCCAGCGCCCG
CCGACGGAGCCGACCCGCCGCCCGCCGAGGAGCCCGAGGCCCGGCCCGACGGCGAGGGTT
CTCCGGGTAAGGCCAGGCCCGGGACCGCCCGCAGGCCCGGGGCAGCCGCGTCGGGGGAAC
GGGACGACCGGGGACCCCCCGCCAGCGTGGCGGCGCTCAGGTCCAACTTCGAGCGGATCC
GCAAGGGCCATGGCCAGCCCGGGGCGGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGT
TTCACCACGAGCGCGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCGGACCGCATCAGCT
CCCTGGGCAGCCAGGCCATGCAGATGGAGCGCAAAAAGTCCCAGCACGGCGCGGGCTCGA
GCGTGGGGGATGCATCCAGGCCCCCTTACCGGGGACGCTCCTCGGAGAGCAGCTGCGGCG
TCGACGGCGACTACGAGGACGCCGAGTTGAACCCCCGCTTCCTGAAGGACAACCTGATCG
ACGCCAATGGCGGTAGCAGGCCCCCTTGGCCGCCCCTGGAGTACCAGCCCTACCAGAGCA
TCTACGTCGGGGGCATGATGGAAGGGGAGGGCAAGGGCCCGCTCCTGCGCAGCCAGAGCA
CCTCTGAGCAGGAGAAGCGCCTTACCTGGCCCCGCAGGTCCTACTCCCCCCGGAGTTTTG
AGGATTGCGGAGGCGGCTATACCCCGGACTGCAGCTCCAATGAGAACCTCACCTCCAGCG
AGGAGGACTTCTCCTCTGGCCAGTCCAGCCGCGTGTCCCCAAGCCCCACCACCTACCGCA
TGTTCCGGGACAAAAGCCGCTCTCCCTCGCAGAACTCGCAACAGTCCTTCGACAGCAGCA
GTCCCCCCACGCCGCAGTGCCATAAGCGGCACCGGCACTGCCCGGTTGTCGTGTCCGAGG
CCACCATCGTGGGCGTCCGCAAGACCGGGCAGATCTGGCCCAACGATGGCGAGGGCGCCT
TCCATGGAGACGCAGATGGCTCGTTCGGAACACCACCTGGATACGGCTGCGCTGCAGACC
GGGCAGAGGAGCAGCGCCGGCACCAAGATGGGCTGCCCTACATTGATGACTCGCCCTCCT
CATCGCCCCACCTCAGCAGCAAGGGCAGGGGCAGCCGGGATGCGCTGGTCTCGGGAGCCC
TGGAGTCCACTAAAGCGAGTGAGCTGGACTTGGAAAAGGGCTTGGAGATGAGAAAATGGG
TCCTGTCGGGAATCCTGGCTAGCGAGGAGACTTACCTGAGCCACCTGGAGGCACTGCTGC
TGCCCATGAAGCCTTTGAAAGCCGCTGCCACCACCTCTCAGCCGGTGCTGACGAGTCAGC
AGATCGAGACCATCTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTATG
ATGGGCTCTTCCCCCGCGTGCAGCAGTGGAGCCACCAGCAGCGGGTGGGCGACCTCTTCC
AGAAGCTGGCCAGCCAGCTGGGTGTGTACCGGGCCTTCGTGGACAACTACGGAGTTGCCA
TGGAAATGGCTGAGAAGTGCTGTCAGGCCAATGCTCAGTTTGCAGAAATCTCCGAGAACC
TGAGAGCCAGAAGCAACAAAGATGCCAAGGATCCAACGACCAAGAACTCTCTGGAAACTC
TGCTCTACAAGCCTGTGGACCGTGTGACGAGGAGCACGCTGGTCCTCCATGACTTGCTGA
AGCACACTCCTGCCAGCCACCCTGACCACCCCTTGCTGCAGGACGCCCTCCGCATCTCAC
AGAACTTCCTGTCCAGCATCAATGAGGAGATCACACCCCGACGGCAGTCCATGACGGTGA
AGAAGGGAGAGCACCGGCAGCTGCTGAAGGACAGCTTCATGGTGGAGCTGGTGGAGGGGG
CCCGCAAGCTGCGCCACGTCTTCCTGTTCACCGACCTGCTTCTCTGCACCAAGCTCAAGA
AGCAGAGCGGAGGCAAAACGCAGCAGTATGACTGCAAATGGTACATTCCGCTCACGGATC
TCAGCTTCCAGATGGTGGATGAACTGGAGGCAGTGCCCAACATCCCCCTGGTGCCCGATG
AGGAGCTGGACGCTTTGAAGATCAAGATCTCCCAGATCAAGAATGACATCCAGAGAGAGA
AGAGGGCGAACAAGGGCAGCAAGGCTACGGAGAGGCTGAAGAAGAAGCTGTCGGAGCAGG
AGTCACTGCTGCTGCTTATGTCTCCCAGCATGGCCTTCAGGGTGCACAGCCGCAACGGCA
AGAGTTACACGTTCCTGATCTCCTCTGACTATGAGCGTGCAGAGTGGAGGGAGAACATCC
GGGAGCAGCAGAAGAAGTGTTTCAGAAGCTTCTCCCTGACATCCGTGGAGCTGCAGATGC
TGACCAACTCGTGTGTGAAACTCCAGACTGTCCACAGCATTCCGCTGACCATCAATAAGG
AAGATGATGAGTCTCCGGGGCTCTATGGGTTTCTGAATGTCATCGTCCACTCAGCCACTG
GATTTAAGCAGAGTTCAAATCTGTACTGCACCCTGGAGGTGGATTCCTTTGGGTATTTTG
TGAATAAAGCAAAGACGCGCGTCTACAGGGACACAGCTGAGCCAAACTGGAACGAGGAAT
TTGAGATAGAGCTGGAGGGCTCCCAGACCCTGAGGATACTGTGCTATGAAAAGTGTTACA
ACAAGACGAAGATCCCCAAGGAGGACGGCGAGAGCACGGACAGACTCATGGGGAAGGGCC
AGGTCCAGCTGGACCCGCAGGCCCTGCAGGACAGAGACTGGCAGCGCACCGTCATCGCCA
TGAATGGGATCGAAGTAAAGCTCTCGGTCAAGTTCAACAGCAGGGAGTTCAGCTTGAAGA
GGATGCCGTCCCGAAAACAGACAGGGGTCTTCGGAGTCAAGATTGCTGTGGTCACCAAGA
GAGAGAGGTCCAAGGTGCCCTACATCGTGCGCCAGTGCGTGGAGGAGATCGAGCGCCGAG
GCATGGAGGAGGTGGGCATCTACCGCGTGTCCGGTGTGGCCACGGACATCCAGGCACTGA
AGGCAGCCTTCGACGTCAATAACAAGGACGTGTCGGTGATGATGAGCGAGATGGACGTGA
ACGCCATCGCAGGCACGCTGAAGCTGTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACTG
ACGAGTTCTACCCCAACTTCGCAGAGGGCATCGCTCTTTCAGACCCGGTTGCAAAGGAGA
GCTGCATGCTCAACCTGCTGCTGTCCCTGCCGGAGGCCAACCTGCTCACCTTCCTTTTCC
TTCTGGACCACCTGAAAAGGGTGGCAGAGAAGGAGGCAGTCAATAAGATGTCCCTGCACA
ACCTCGCCACGGTCTTTGGCCCCACGCTGCTCCGGCCCTCCGAGAAGGAGAGCAAGCTCC
CTGCCAACCCCAGCCAGCCTATCACCATGACTGACAGCTGGTCCTTGGAGGTCATGTCCC
AGGTCCAGGTGCTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCGGACAGCAAGA
GACAGAGCATCCTGTTCTCCACCGAAGTCTAAAGGTCCCAGTCCATCTCCTGGAGGCGGA
CAGATGGCCTGGAAACCTCTGGCTAATCGGGCCATCCGTAGAGCGGGAACCTTCCTGAGG
TGTCCTTGGGCCACCCCCAAGTGTTGGGCCATCTGCCAAGAGACAGCGACCCAAAGCCGA
AGGACAGGTGGCCTGGAAAGATCCCGCCCAGGTCTGGGAGCCCCAGGCTGGCCTCAGACT
GTGGTTTTTTATGTGGCCACCTGAGGGCGCCCCAAGCCAGTTCATCTCGGAGTCCAGGCC
TGGCCCTGGGAGACAGGGTGAAGGGAGTGGTTTTTATGAACTTAACTTAGAGTCTAAAAG
ATTTCTACTGGATCACTTGTCAAGATGCGCCCTCTCTGGGGAGAAGGGAACGTGACTGGA
TTCCCTCACTGTTGTATCTTGAATAAACGCTGCTGCTTCATCCTGTGGGGGCCGTGGCCC
TGTCCCTGTGTGGGTGGGGCCTCTTCCATTTCCCTGACTTAGAAACCACACTCCACTTCT
AACAGGGTTTGAGAGGCTTAGTCAGCACTGGGTAGCGTTTTGACTCCATTCTTGGCTTTC
TTTTTCTTTCCAGAAGGATTTTTGTGCAGAAATGGGTCTTTTGTTGCCATGTTAGTCCTC
CTTGGAAGGCAGCTCAGAAGGCCTGTGAAATGTCAGGGGACAGGACCCCCAGGGAGGGAA
CCCCAGGCTACGCACTTTAGGGTTCGTTCTCCAGGGAGAGCGACCTCGTCCCCCGATCCT
GACCGCCCTTCCGGCCCACGCTCTCCTGTTTGGCTTCCACAGGCCTGGACTTCTCTGGCT
TCTCTGCCCACACACTCCCTGCCCCCAGTGTCCCTGCCCCTGCCCCAGCACAGGTGACTT
CATTTCTGTCCTCTCAGCTCAGTGGACTCGCTCAACTTTTGTATAAGTCTCCACTTGGTG
GCAGCAGCTTGCTGATGACTTGTTTTAAAACTTTCATCCTAAATAACCTTTTGATACTTG
AATATTTGTAAGTTTTATACATAGTTTCTAATTTTTTTCCGAACAGATCCAGATACCTAA
TAAGATGCTGGAATGTAATCCCTGGACAATCCGTGTCCTGGCAGCATTTGGTCTTCCTCT
AAGCGCCTGGCTCCGCTGTTCTCAGGAGTGGGTTCTGAAGTCTCTGGAGAACAGGATACG
TGGAGGGTTAGGAAGGGGCCAGGCCTAGAGACGGGAGACTCCCTCCCGGAGCAGGTGGAG
GCACAGGACCATTCGCTACCCCATCTGCCGACACCTGCGGGGGAGCCCAGGCATTCTTTG
TAAACCCTCCTGACCACCTGGCTCAAAGAAAACAGAAGCATGGAGACCGCCAAGTATTTT
CAAGAAATAACCCCATGAATATTCCATCACTTTTTTAGAAAGAGGGGCTTGGGGCAGGCA
GAGGAGAGAAGGGAGAGCAAACTGAGAGCCAAGTTTCCACACGGTCCTGCAGGAGGAGAG
GATGCAGCTGCCCAGAGGGAAGCAGGATCACATTTAAGGAAGTGTGTGGGGTCCCTGGAT
GACACCAGCACCCAGTGCGGCTCTGTCTGGCACCCGCTCCCAAGGTGGGAGGAGTGGGTG
TCCCCTGTGTGTCAGTGGGCAGCTCCTGCTGAACCCGCAGCTCACTAGGGAGCCTGACAG
TGGGGCCATGCGCCTGACACTCCTCTCTGCTTGTGGACCTGGCAAGGCAGGGAGCAGAAA
ACAGCCACTTGAAGGCTTTCTGTCTGCGTCTGTGTGCAGTGTGGATTTAGTTGTGCTTTT
TTCTTGCTGGGAGAGCACAGCCACCATTTACAAGCAGTGTCACCGTCGTGGGTGGCGAGG
ACAGAACAGGAGCCTCTGCTCTCTGTACCTATCTGGGCCCGGTGGGCTCCCTTGTCCTGG
CTTCCATCTCTGTCTCAGCGACCATTCAGCCCTGCGCAGGAACACGTGTTGCTTAGAAAA
GCCAAATCCAGCCTTGTCTCTGCCTCCTCTGGTCTCATGATGTGCATCTGTTACCTTGAA
ACTGGAAACCAGTCTATCAATGTCTGTGCCAATTTTTTATTCCCTCCCCAACCTCCTTCC
CCATACGACTTTTTATTTATGTAGGATGTGTGCTGTCTAATGATGGGATGACCACACTTT
TCCATGTTCTAAAAGTGCTCCTCTCCCGCAGGGTCCCAGGGCTGGTGGTTGCTTTGGGTC
TACAGCTACGTCTTACCCACCTCCTGCCTCAACAGCCTGTGTGGTGGCAAAGCCGGTGTG
GGGCTGGGGAACGCAGCGTTCTCCAGGAGGGGGACCTGGCTCTCCTTCTGCAATGCAGGC
GAAGGCCTAGATGCCAGTGTGACCTCCCACAAGGCGTGGCTTCCAGACTCCCCGGCCGGA
AGTGATGCTTTTTTGCCTTGGGCCCTGGGTTTGAAGCAGCCTGGCTTTCTCTTGGTAAGT
GGCTGGTGTCTTAGCAGCTGCAATCTGAGCTCAGCCACCTACACACCACCGTGGCCGACA
CTTTCATTAAAAAGTTTCCTGAGACGA

Protein Sequence

>613 : length: 1271
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQ
TLLAKEKKSYDRQRWGFRRAAQAPDGASEPRASASRPQPAPADGADPPPAEEPEARPDGE
GSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSC
GVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQSIYVGGMMEGEGKGPLLRSQ
STSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEG
AFHGDADGSFGTPPGYGCAADRAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGSRDALVSG
ALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGV
AMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDL
LKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVE
GARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDELEAVPNIPLVP
DEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRN
GKSYTFLISSDYERAEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTIN
KEDDESPGLYGFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNE
EFEIELEGSQTLRILCYEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVI
AMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIER
RGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLF
TDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSL
HNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAPDS
KRQSILFSTEV