ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6098

Name

ROS1

Synonym

MCF3|ROS|c-ros-1;ROS proto-oncogene 1 , receptor tyrosine kinase;ROS1;ROS proto-oncogene 1 , receptor tyrosine kinase

Definition

c-ros oncogene 1 , receptor tyrosine kinase|proto-oncogene c-Ros-1|proto-oncogene tyrosine-protein kinase ROS|transmembrane tyrosine-specific protein kinase|v-ros avian UR2 sarcoma virus oncogene homolog 1

Position

6q22

Gene Type

protein-coding

External Links

Links to cell senescence gene database

6098

Links to epithelial mesenchymal transition gene database

6098

Links to ovarian cancer gene database

6098

Links to endometrial cancer gene database

6098

Links to iHOP

6098

Sequence Information

Nucleotide Sequence

>6098 : length: 7910
TCACTGGGTGACTTTATGGGAGTAAAAGGAAGCTGTTATGAAATAGCTCTTATGGAACTG
TTACAAGCTTTCAAGCATTCAAAGGTCTAAATGAAAAAGGCTAAGTATTATTTCAAAAGG
CAAGTATATCCTAATATAGCAAAACAAACAAAGCAAAATCCATCAGCTACTCCTCCAATT
GAAGTGATGAAGCCCAAATAATTCATATAGCAAAATGGAGAAAATTAGACCGGCCATCTA
AAAATCTGCCATTGGTGAAGTGATGAAGAACATTTACTGTCTTATTCCGAAGCTTGTCAA
TTTTGCAACTCTTGGCTGCCTATGGATTTCTGTGGTGCAGTGTACAGTTTTAAATAGCTG
CCTAAAGTCGTGTGTAACTAATCTGGGCCAGCAGCTTGACCTTGGCACACCACATAATCT
GAGTGAACCGTGTATCCAAGGATGTCACTTTTGGAACTCTGTAGATCAGAAAAACTGTGC
TTTAAAGTGTAATGATACTTATGCCACCGTTTGTGAGCGGGAGTCGTGTGAGGTTGGCTG
TAGCAGCGCGGAAGGTGCATATGAAGAGGAAGTACTGGAAAATGCAGACCTACCAACTGC
TCCCTTTGCTTCTTCCATTGGAAGCCACAATATGACATTACGATGGAAATCTGCAAACTT
CTCTGGAGTAAAATACATCATTCAGTGGAAATATGCACAACTTCTGGGAAGCTGGACTTA
TACTAAGACTGTGTCCAGACCGTCCTATGTGGTCAAGCCCCTGCACCCCTTCACTGAGTA
CATTTTCCGAGTGGTTTGGATCTTCACAGCGCAGCTGCAGCTCTACTCCCCTCCAAGTCC
CAGTTACAGGACTCATCCTCATGGAGTTCCTGAAACTGCACCTTTGATTAGGAATATTGA
GAGCTCAAGTCCCGACACTGTGGAAGTCAGCTGGGATCCACCTCAATTCCCAGGTGGACC
TATTTTGGGTTATAACTTAAGGCTGATCAGCAAAAATCAAAAATTAGATGCAGGGACACA
GAGAACCAGTTTCCAGTTTTACTCCACTTTACCAAATACTATCTACAGGTTTTCTATTGC
AGCAGTAAATGAAGTTGGTGAGGGTCCAGAAGCAGAATCTAGTATTACCACTTCATCTTC
AGCAGTTCAACAAGAGGAACAGTGGCTCTTTTTATCCAGAAAAACTTCTCTAAGAAAGAG
ATCTTTAAAACATTTAGTAGATGAAGCACATTGCCTTCGGTTGGATGCTATATACCATAA
TATTACAGGAATATCTGTTGATGTCCACCAGCAAATTGTTTATTTCTCTGAAGGAACTCT
CATATGGGCGAAGAAGGCTGCCAACATGTCTGATGTATCTGACCTGAGAATTTTTTACAG
AGGTTCAGGATTAATTTCTTCTATCTCCATAGATTGGCTTTATCAAAGAATGTATTTCAT
CATGGATGAACTGGTATGTGTCTGTGATTTAGAGAACTGCTCAAACATCGAGGAAATTAC
TCCACCCTCTATTAGTGCACCTCAAAAAATTGTGGCTGATTCATACAATGGGTATGTCTT
TTACCTCCTGAGAGATGGCATTTATAGAGCAGACCTTCCTGTACCATCTGGCCGGTGTGC
AGAAGCTGTGCGTATTGTGGAGAGTTGCACGTTAAAGGACTTTGCAATCAAGCCACAAGC
CAAGCGAATCATTTACTTCAATGACACTGCCCAAGTCTTCATGTCAACATTTCTGGATGG
CTCTGCTTCCCATCTCATCCTACCTCGCATCCCCTTTGCTGATGTGAAAAGTTTTGCTTG
TGAAAACAATGACTTTCTTGTCACAGATGGCAAGGTCATTTTCCAACAGGATGCTTTGTC
TTTTAATGAATTCATCGTGGGATGTGACCTGAGTCACATAGAAGAATTTGGGTTTGGTAA
CTTGGTCATCTTTGGCTCATCCTCCCAGCTGCACCCTCTGCCAGGCCGCCCGCAGGAGCT
TTCGGTGCTGTTTGGCTCTCACCAGGCTCTTGTTCAATGGAAGCCTCCTGCCCTTGCCAT
AGGAGCCAATGTCATCCTGATCAGTGATATTATTGAACTCTTTGAATTAGGCCCTTCTGC
CTGGCAGAACTGGACCTATGAGGTGAAAGTATCCACCCAAGACCCTCCTGAAGTCACTCA
TATTTTCTTGAACATAAGTGGAACCATGCTGAATGTACCTGAGCTGCAGAGTGCTATGAA
ATACAAGGTTTCTGTGAGAGCAAGTTCTCCAAAGAGGCCAGGCCCCTGGTCAGAGCCCTC
AGTGGGTACTACCCTGGTGCCAGCTAGTGAACCACCATTTATCATGGCTGTGAAAGAAGA
TGGGCTTTGGAGTAAACCATTAAATAGCTTTGGCCCAGGAGAGTTCTTATCCTCTGATAT
AGGAAATGTGTCAGACATGGATTGGTATAACAACAGCCTCTACTACAGTGACACGAAAGG
CGACGTTTTTGTGTGGCTGCTGAATGGGACGGATATCTCAGAGAATTATCACCTACCCAG
CATTGCAGGAGCAGGGGCTTTAGCTTTTGAGTGGCTGGGTCACTTTCTCTACTGGGCTGG
AAAGACATATGTGATACAAAGGCAGTCTGTGTTGACGGGACACACAGACATTGTTACCCA
CGTGAAGCTATTGGTGAATGACATGGTGGTGGATTCAGTTGGTGGATATCTCTACTGGAC
CACACTCTATTCAGTGGAAAGCACCAGACTAAATGGGGAAAGTTCCCTTGTACTACAGAC
ACAGCCTTGGTTTTCTGGGAAAAAGGTAATTGCTCTAACTTTAGACCTCAGTGATGGGCT
CCTGTATTGGTTGGTTCAAGACAGTCAATGTATTCACCTGTACACAGCTGTTCTTCGGGG
ACAGAGCAGCACTGGGGATACCACCATCACAGAATTTGCAGCCTGGAGTACTTCTGAAAT
TTCCCAGAATGCACTGATGTACTATAGTGGTCGGCTGTTCTGGATCAATGGCTTTAGGAT
TATCACAACTCAAGAAATAGGTCAGAAAACCAGTGTCTCTGTTTTGGAACCAGCCAGATT
TAATCAGTTCACAATTATTCAGACATCCCTTAAGCCCCTGCCAGGGAACTTTTCCTTTAC
CCCTAAGGTTATTCCAGATTCTGTTCAAGAGTCTTCATTTAGGATTGAAGGAAATGCTTC
AAGTTTTCAAATCCTGTGGAATGGTCCCCCTGCGGTAGACTGGGGTGTAGTTTTCTACAG
TGTAGAATTTAGTGCTCATTCTAAGTTCTTGGCTAGTGAACAACACTCTTTACCTGTATT
TACTGTGGAAGGACTGGAACCTTATGCCTTATTTAATCTTTCTGTCACTCCTTATACCTA
CTGGGGAAAGGGCCCCAAAACATCTCTGTCACTTCGAGCACCTGAAACAGTTCCATCAGC
ACCAGAGAACCCCAGAATATTTATATTACCAAGTGGAAAATGCTGCAACAAGAATGAAGT
TGTGGTGGAATTTAGGTGGAACAAACCTAAGCATGAAAATGGGGTGTTAACAAAATTTGA
AATTTTCTACAATATATCCAATCAAAGTATTACAAACAAAACATGTGAAGACTGGATTGC
TGTCAATGTCACTCCCTCAGTGATGTCTTTTCAACTTGAAGGCATGAGTCCCAGATGCTT
TATTGCCTTCCAGGTTAGGGCCTTTACATCTAAGGGGCCAGGACCATATGCTGACGTTGT
AAAGTCTACAACATCAGAAATCAACCCATTTCCTCACCTCATAACTCTTCTTGGTAACAA
GATAGTTTTTTTAGATATGGATCAAAATCAAGTTGTGTGGACGTTTTCAGCAGAAAGAGT
TATCAGTGCCGTTTGCTACACAGCTGATAATGAGATGGGATATTATGCTGAAGGGGACTC
ACTCTTTCTTCTGCACTTGCACAATCGCTCTAGCTCTGAGCTTTTCCAAGATTCACTGGT
TTTTGATATCACAGTTATTACAATTGACTGGATTTCAAGGCACCTCTACTTTGCACTGAA
AGAATCACAAAATGGAATGCAAGTATTTGATGTTGATCTTGAACACAAGGTGAAATATCC
CAGAGAGGTGAAGATTCACAATAGGAATTCAACAATAATTTCTTTTTCTGTATATCCTCT
TTTAAGTCGCTTGTATTGGACAGAAGTTTCCAATTTTGGCTACCAGATGTTCTACTACAG
TATTATCAGTCACACCTTGCACCGAATTCTGCAACCCACAGCTACAAACCAACAAAACAA
AAGGAATCAATGTTCTTGTAATGTGACTGAATTTGAGTTAAGTGGAGCAATGGCTATTGA
TACCTCTAACCTAGAGAAACCATTGATATACTTTGCCAAAGCACAAGAGATCTGGGCAAT
GGATCTGGAAGGCTGTCAGTGTTGGAGAGTTATCACAGTACCTGCTATGCTCGCAGGAAA
AACCCTTGTTAGCTTAACTGTGGATGGAGATCTTATATACTGGATCATCACAGCAAAGGA
CAGCACACAGATTTATCAGGCAAAGAAAGGAAATGGGGCCATCGTTTCCCAGGTGAAGGC
CCTAAGGAGTAGGCATATCTTGGCTTACAGTTCAGTTATGCAGCCTTTTCCAGATAAAGC
GTTTCTGTCTCTAGCTTCAGACACTGTGGAACCAACTATACTTAATGCCACTAACACTAG
CCTCACAATCAGATTACCTCTGGCCAAGACAAACCTCACATGGTATGGCATCACCAGCCC
TACTCCAACATACCTGGTTTATTATGCAGAAGTTAATGACAGGAAAAACAGCTCTGACTT
GAAATATAGAATTCTGGAATTTCAGGACAGTATAGCTCTTATTGAAGATTTACAACCATT
TTCAACATACATGATACAGATAGCTGTAAAAAATTATTATTCAGATCCTTTGGAACATTT
ACCACCAGGAAAAGAGATTTGGGGAAAAACTAAAAATGGAGTACCAGAGGCAGTGCAGCT
CATTAATACAACTGTGCGGTCAGACACCAGCCTCATTATATCTTGGAGAGAATCTCACAA
GCCAAATGGACCTAAAGAATCAGTCCGTTATCAGTTGGCAATCTCACACCTGGCCCTAAT
TCCTGAAACTCCTCTAAGACAAAGTGAATTTCCAAATGGAAGGCTCACTCTCCTTGTTAC
TAGACTGTCTGGTGGAAATATTTATGTGTTAAAGGTTCTTGCCTGCCACTCTGAGGAAAT
GTGGTGTACAGAGAGTCATCCTGTCACTGTGGAAATGTTTAACACACCAGAGAAACCTTA
TTCCTTGGTTCCAGAGAACACTAGTTTGCAATTTAATTGGAAGGCTCCATTGAATGTTAA
CCTCATCAGATTTTGGGTTGAGCTACAGAAGTGGAAATACAATGAGTTTTACCATGTTAA
AACTTCATGCAGCCAAGGTCCTGCTTATGTCTGTAATATCACAAATCTACAACCTTATAC
TTCATATAATGTCAGAGTAGTGGTGGTTTATAAGACGGGAGAAAATAGCACCTCACTTCC
AGAAAGCTTTAAGACAAAAGCTGGAGTCCCAAATAAACCAGGCATTCCCAAATTACTAGA
AGGGAGTAAAAATTCAATACAGTGGGAGAAAGCTGAAGATAATGGATGTAGAATTACATA
CTATATCCTTGAGATAAGAAAGAGCACTTCAAATAATTTACAGAACCAGAATTTAAGGTG
GAAGATGACATTTAATGGATCCTGCAGTAGTGTTTGCACATGGAAGTCCAAAAACCTGAA
AGGAATATTTCAGTTCAGAGTAGTAGCTGCAAATAATCTAGGGTTTGGTGAATATAGTGG
AATCAGTGAGAATATTATATTAGTTGGAGATGATTTTTGGATACCAGAAACAAGTTTCAT
ACTTACTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACCTTTGTCTGGCA
TAGAAGATTAAAGAATCAAAAAAGTGCCAAGGAAGGGGTGACAGTGCTTATAAACGAAGA
CAAAGAGTTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGCTA
TGCAATACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGA
AAAACTGACTCTGCGTCTCTTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAAC
AGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGAAGACTTTGAA
GAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAA
ATTTAATCATCCCAACATTCTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATA
CATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTAAAGCCCGGAT
GGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATAT
TTCAAAAGGCTGTGTCTACTTGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAG
AAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGATTGGAGACTT
TGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCT
CCCAGTTCGGTGGATGGCTCCAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGA
TGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATCAGCCTTATCC
AGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACC
AAGAAATTGTCCTGATGATCTGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGA
CCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAAATTTTTTCTT
AAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTT
TGAAGGTGAAGATGGCGATGTGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTT
AATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAGAATGTGGCCA
AGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAG
GAAAGAAGAGAAGGAACCACATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTA
CTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCACAGTGGATATGG
AGATGGGTCTGATTAATAGCGTTGTTTGGGAAATAGAGAGTTGAGATAAACACTCTCATT
CAGTAGTTACTGAAAGAAAACTCTGCTAGAATGATAAATGTCATGGTGGTCTATAACTCC
AAATAAACAATGCAACGTTCCTGATTTCTAATCTTGGTTCTGAGAGCCATTTGGTTTCAG
TTGTAGCAATCCCCATACCAGCTGCCTGACTTTCAGTAGAATTATGAGATGAACACTAAG
CATGTGGAAAGCTTAGGAAGACTCAGAAGTCTGGAAGGGAAACACTGCTCTCCCTTCTCC
CTTGAGGTGCTTTAGGCTCTTACCCACCTTTCAGTTTGGGCTGTAATAAAAATATCTTGG
CCACATGTTTAGAGACAGAATAGGTGTGTTCAGCGATATAAAGAAGAGGCTAAGGAGTAG
GCTCAGGGGGGTCAACTGAACTACAGATAATCTCAAATGGGACCAAGGAAATGAGAAATA
ATTTCACACATACAGAAGAAACCAGCACCTGTGACTTGAGAAATCACTTGGAAAGCTGTT
ACTGCAATGATATATATATTATCTTTTTTTAATTTTTTTTTTTTTTTTTT

Protein Sequence

>6098 : length: 2357
MKNIYCLIPKLVNFATLGCLWISVVQCTVLNSCLKSCVTNLGQQLDLGTPHNLSEPCIQG
CHFWNSVDQKNCALKCNDTYATVCERESCEVGCSSAEGAYEEEVLENADLPTAPFASSIG
SHNMTLRWKSANFSGVKYIIQWKYAQLLGSWTYTKTVSRPSYVVKPLHPFTEYIFRVVWI
FTAQLQLYSPPSPSYRTHPHGVPETAPLIRNIESSSPDTVEVSWDPPQFPGGPILGYNLR
LISKNQKLDAGTQRTSFQFYSTLPNTIYRFSIAAVNEVGEGPEAESSITTSSSAVQQEEQ
WLFLSRKTSLRKRSLKHLVDEAHCLRLDAIYHNITGISVDVHQQIVYFSEGTLIWAKKAA
NMSDVSDLRIFYRGSGLISSISIDWLYQRMYFIMDELVCVCDLENCSNIEEITPPSISAP
QKIVADSYNGYVFYLLRDGIYRADLPVPSGRCAEAVRIVESCTLKDFAIKPQAKRIIYFN
DTAQVFMSTFLDGSASHLILPRIPFADVKSFACENNDFLVTDGKVIFQQDALSFNEFIVG
CDLSHIEEFGFGNLVIFGSSSQLHPLPGRPQELSVLFGSHQALVQWKPPALAIGANVILI
SDIIELFELGPSAWQNWTYEVKVSTQDPPEVTHIFLNISGTMLNVPELQSAMKYKVSVRA
SSPKRPGPWSEPSVGTTLVPASEPPFIMAVKEDGLWSKPLNSFGPGEFLSSDIGNVSDMD
WYNNSLYYSDTKGDVFVWLLNGTDISENYHLPSIAGAGALAFEWLGHFLYWAGKTYVIQR
QSVLTGHTDIVTHVKLLVNDMVVDSVGGYLYWTTLYSVESTRLNGESSLVLQTQPWFSGK
KVIALTLDLSDGLLYWLVQDSQCIHLYTAVLRGQSSTGDTTITEFAAWSTSEISQNALMY
YSGRLFWINGFRIITTQEIGQKTSVSVLEPARFNQFTIIQTSLKPLPGNFSFTPKVIPDS
VQESSFRIEGNASSFQILWNGPPAVDWGVVFYSVEFSAHSKFLASEQHSLPVFTVEGLEP
YALFNLSVTPYTYWGKGPKTSLSLRAPETVPSAPENPRIFILPSGKCCNKNEVVVEFRWN
KPKHENGVLTKFEIFYNISNQSITNKTCEDWIAVNVTPSVMSFQLEGMSPRCFIAFQVRA
FTSKGPGPYADVVKSTTSEINPFPHLITLLGNKIVFLDMDQNQVVWTFSAERVISAVCYT
ADNEMGYYAEGDSLFLLHLHNRSSSELFQDSLVFDITVITIDWISRHLYFALKESQNGMQ
VFDVDLEHKVKYPREVKIHNRNSTIISFSVYPLLSRLYWTEVSNFGYQMFYYSIISHTLH
RILQPTATNQQNKRNQCSCNVTEFELSGAMAIDTSNLEKPLIYFAKAQEIWAMDLEGCQC
WRVITVPAMLAGKTLVSLTVDGDLIYWIITAKDSTQIYQAKKGNGAIVSQVKALRSRHIL
AYSSVMQPFPDKAFLSLASDTVEPTILNATNTSLTIRLPLAKTNLTWYGITSPTPTYLVY
YAEVNDRKNSSDLKYRILEFQDSIALIEDLQPFSTYMIQIAVKNYYSDPLEHLPPGKEIW
GKTKNGVPEAVQLINTTVRSDTSLIISWRESHKPNGPKESVRYQLAISHLALIPETPLRQ
SEFPNGRLTLLVTRLSGGNIYVLKVLACHSEEMWCTESHPVTVEMFNTPEKPYSLVPENT
SLQFNWKAPLNVNLIRFWVELQKWKYNEFYHVKTSCSQGPAYVCNITNLQPYTSYNVRVV
VVYKTGENSTSLPESFKTKAGVPNKPGIPKLLEGSKNSIQWEKAEDNGCRITYYILEIRK
STSNNLQNQNLRWKMTFNGSCSSVCTWKSKNLKGIFQFRVVAANNLGFGEYSGISENIIL
VGDDFWIPETSFILTIIVGIFLVVTIPLTFVWHRRLKNQKSAKEGVTVLINEDKELAELR
GLAAGVGLANACYAIHTLPTQEEIENLPAFPREKLTLRLLLGSGAFGEVYEGTAVDILGV
GSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELME
GGDLLTYLRKARMATFYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVK
DYTSPRIVKIGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGIL
IWEILTLGHQPYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHR
IQDQLQLFRNFFLNSIYKSRDEANNSGVINESFEGEDGDVICLNSDDIMPVALMETKNRE
GLNYMVLATECGQGEEKSEGPLGSQESESCGLRKEEKEPHADKDFCQEKQVAYCPSGKPE
GLNYACLTHSGYGDGSD