ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

607

Name

BCL9

Synonym

LGS;B-cell CLL/lymphoma 9;BCL9;B-cell CLL/lymphoma 9

Definition

B-cell CLL/lymphoma 9 protein|B-cell lymphoma 9 protein|bcl-9|protein legless homolog

Position

1q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

Wnt signaling pathway;PANTHER;P00057

External Links

Links to cell senescence gene database

607

Links to epithelial mesenchymal transition gene database

607

Links to ovarian cancer gene database

607

Links to endometrial cancer gene database

607

Links to iHOP

607

Sequence Information

Nucleotide Sequence

>607 : length: 6253
CTTGAGACAAGCTTCCATGTGTGAAAGCTACTTGGCATGAATGCCTGGGCCGTACCAAGT
GTCACCGCAGCAAGAGGGGGAGTCAGAAGAAAAACAGATCAGACCAGAGCAGACAATAGG
CCCCTAAAGTGTTCCCCCTAAGTTGCTTTGATGTTGTCCTGGTGTCTTGATACCAGGAGG
CCAGGGATTGCGGGAAAAGGGTCTTTTTTGTCTTCATTCACTTTCCCCCCTCAGTTTCTG
AAATGATTCTCCAGAATTTCTCCTCATAAAAAAGGACTGAATGTGGGCCCAGTTGGCGTC
ATTCTGCTTTGACCTAAACATTCCCATCTGATTGGGTGGCAGAGATCATTTTTGGAAAGT
TCTTCCGTGTCCCGATGTAGAAGAAATAGCAAATTGGACATATTGAAAGACAAGGGTCAT
CTTTGAGAAGGGGGTTCCTGGACTCCTCACCTCCAGGATGAGCACTGCAGTGTCGTGACC
CTTGGGGTTTTGTATGCCCTGGAGATGCGAGATTTTCCTCTGGCAGCAGGAGGCACGCAC
CCAGAGAATGCTGGAGCTGCAAGGGGAAAGGACCCACTTCCACAGCAGAGAAAAACAAAG
AGGAAAAAGGCATACAGGCAGCGAGCGCTAAGGGACGCACCCAGCAAGCAGTGGGCCAGT
GCCACTGCCCCCAGCAGCTGTTTCTGCTGCAACCCGAGAGGAACTCGGTGAGCCTGTCCC
GTTTGTGACTGCAAGCTCAGGATTTCAATCAATGCATTCCAGTAACCCTAAAGTGAGGAG
CTCTCCATCAGGAAACACACAGAGTAGCCCTAAGTCAAAGCAGGAGGTGATGGTCCGTCC
CCCTACAGTGATGTCCCCATCTGGAAACCCCCAGCTGGATTCCAAATTCTCCAATCAGGG
TAAACAGGGGGGCTCAGCCAGCCAATCCCAGCCATCCCCCTGTGACTCCAAGAGTGGGGG
CCATACCCCTAAAGCACTCCCTGGCCCAGGTGGGAGCATGGGGCTGAAGAATGGGGCTGG
AAATGGTGCCAAGGGCAAGGGGAAAAGGGAGCGAAGTATTTCCGCCGACTCCTTTGATCA
GAGAGATCCTGGGACTCCAAACGATGACTCTGACATTAAAGAATGTAATTCTGCTGACCA
CATAAAGTCCCAGGATTCCCAGCACACACCACACTCGATGACCCCATCAAATGCTACAGC
CCCCAGGTCTTCTACCCCCTCCCATGGCCAAACTACTGCCACAGAGCCCACACCTGCTCA
GAAGACTCCAGCCAAAGTGGTGTACGTGTTTTCTACTGAGATGGCCAATAAAGCTGCAGA
AGCTGTTTTGAAGGGCCAGGTTGAAACTATCGTCTCTTTCCACATCCAGAACATTTCTAA
CAACAAGACAGAGAGAAGCACAGCGCCTCTGAACACACAGATATCTGCCCTTCGGAATGA
TCCGAAACCTCTCCCACAACAGCCCCCAGCTCCGGCCAACCAGGACCAGAATTCTTCCCA
GAATACCAGACTGCAGCCAACTCCACCCATTCCGGCACCAGCACCCAAGCCTGCCGCACC
CCCACGTCCCCTGGACCGGGAGAGTCCTGGGGTAGAAAACAAACTGATTCCTTCTGTAGG
AAGTCCTGCCAGCTCCACTCCACTGCCCCCAGATGGTACTGGGCCCAACTCAACTCCCAA
CAATAGGGCAGTGACCCCTGTCTCCCAGGGGAGCAATAGCTCTTCAGCAGATCCCAAAGC
CCCTCCGCCTCCACCAGTGTCCAGTGGCGAGCCCCCCACACTGGGAGAGAATCCCGATGG
CCTATCTCAGGAGCAGCTGGAGCACCGGGAGCGCTCCTTACAAACTCTCAGAGATATCCA
GCGCATGCTTTTTCCTGATGAGAAAGAATTCACAGGAGCACAAAGTGGGGGACCGCAGCA
GAATCCTGGGGTATTAGATGGGCCTCAGAAAAAACCAGAAGGGCCAATACAGGCCATGAT
GGCCCAATCCCAAAGCCTAGGTAAGGGACCTGGGCCCCGGACAGACGTGGGAGCTCCATT
TGGCCCTCAAGGACATAGAGATGTACCCTTTTCTCCAGATGAAATGGTTCCACCTTCTAT
GAACTCCCAGTCTGGGACCATAGGACCCGACCACCTTGACCATATGACTCCCGAGCAGAT
AGCGTGGCTGAAACTGCAGCAGGAGTTTTATGAAGAGAAGAGGAGGAAGCAGGAACAAGT
GGTTGTCCAGCAGTGTTCCCTCCAGGACATGATGGTCCATCAGCACGGGCCTCGGGGAGT
GGTCCGAGGACCCCCCCCTCCATACCAGATGACCCCTAGTGAAGGCTGGGCACCTGGGGG
TACAGAGCCATTTTCTGATGGTATCAACATGCCACATTCTCTGCCCCCGAGGGGCATGGC
TCCCCACCCCAACATGCCAGGGAGCCAGATGCGCCTCCCTGGATTTGCAGGCATGATAAA
CTCTGAAATGGAAGGGCCGAATGTCCCCAACCCTGCATCTAGACCAGGTCTTTCTGGAGT
CAGTTGGCCAGATGATGTGCCAAAAATCCCAGATGGTCGAAATTTTCCTCCTGGCCAGGG
CATTTTCAGCGGTCCTGGCCGAGGGGAACGCTTCCCAAACCCCCAAGGATTGTCTGAAGA
GATGTTTCAGCAGCAGCTGGCAGAGAAACAGCTGGGTCTCCCCCCAGGGATGGCCATGGA
AGGCATCAGGCCCAGCATGGAGATGAACAGGATGATTCCAGGCTCCCAGCGCCACATGGA
GCCTGGGAATAACCCCATTTTCCCTCGAATACCAGTTGAGGGCCCTCTGAGTCCTTCTAG
GGGTGACTTTCCAAAAGGAATTCCCCCACAGATGGGCCCTGGTCGGGAACTTGAGTTTGG
GATGGTTCCTAGTGGGATGAAGGGAGATGTCAATCTAAATGTCAACATGGGATCCAACTC
TCAGATGATACCTCAGAAGATGAGAGAGGCTGGGGCGGGCCCTGAGGAGATGCTGAAATT
ACGCCCAGGTGGCTCAGACATGCTGCCTGCTCAGCAGAAGATGGTGCCACTGCCATTTGG
TGAGCACCCCCAGCAGGAGTATGGCATGGGCCCCAGACCATTCCTTCCCATGTCTCAGGG
TCCAGGCAGCAACAGTGGCTTGCGGAATCTCAGAGAACCAATTGGGCCCGACCAGAGGAC
TAACAGCCGGCTCAGTCATATGCCACCACTACCTCTCAACCCTTCCAGTAACCCCACCAG
CCTCAACACAGCTCCTCCAGTTCAGCGCGGCCTGGGGCGGAAGCCCTTGGATATATCTGT
GGCAGGCAGCCAGGTGCATTCCCCAGGCATTAACCCTCTGAAGTCTCCCACGATGCACCA
AGTCCAGTCACCAATGCTGGGCTCGCCCTCGGGGAACCTCAAGTCCCCCCAGACTCCATC
GCAGCTGGCAGGCATGCTGGCGGGCCCAGCTGCTGCTGCTTCCATTAAGTCCCCCCCTGT
TTTGGGGTCTGCTGCTGCTTCACCTGTCCACCTCAAGTCTCCATCACTTCCTGCCCCGTC
ACCTGGATGGACCTCTTCTCCAAAACCTCCCCTTCAGAGTCCTGGGATCCCTCCAAACCA
TAAAGCACCCCTCACCATGGCCTCCCCAGCCATGCTGGGAAATGTAGAGTCAGGTGGCCC
CCCACCTCCTACAGCCAGCCAGCCTGCCTCTGTGAATATCCCTGGAAGTCTTCCCTCTAG
TACACCTTATACCATGCCTCCAGAGCCAACCCTTTCCCAGAACCCACTCTCTATTATGAT
GTCTCGAATGTCCAAGTTTGCAATGCCCAGTTCCACCCCGTTATACCATGATGCTATCAA
GACTGTGGCCAGCTCAGATGACGACTCCCCTCCAGCTCGTTCTCCCAACTTGCCATCAAT
GAATAATATGCCAGGTCCAAACCCCGTGGTTCCGATGCCAACCCTCAGCCCAATGGGAAT
GACCCAGCCACTTTCTCACTCCAATCAGATGCCCTCTCCAAATGCCGTGGGACCCAACAT
ACCTCCTCATGGGGTCCCAATGGGGCCTGGCTTGATGTCACACAATCCTATCATGGGGCA
TGGGTCCCAGGAGCCACCGATGGTACCTCAAGGACGGATGGGCTTCCCCCAGGGCTTCCC
TCCAGTACAGTCTCCCCCACAGCAGGTTCCATTCCCTCACAATGGCCCCAGTGGGGGGCA
GGGCAGCTTCCCAGGAGGGATGGGTTTCCCAGGAGAAGGCCCCCTTGGCCGCCCCAGCAA
CCTGCCCCAAAGTTCAGCAGATGCAGCACTTTGCAAGCCTGGAGGCCCCGGGGGTCCTGA
CTCCTTCACTGTCCTGGGGAACAGCATGCCTTCGGTGTTTACAGACCCAGATCTGCAGGA
GGTCATCCGACCTGGAGCCACCGGAATACCTGAGTTTGATCTATCCCGCATTATTCCATC
TGAGAAGCCCAGCCAGACGCTGCAATATTTCCCTCGAGGGGAAGTTCCAGGCCGTAAACA
GCCCCAGGGTCCTGGACCTGGGTTTTCACACATGCAGGGGATGATGGGCGAACAAGCCCC
CAGAATGGGACTAGCATTACCTGGCATGGGAGGTCCAGGGCCAGTGGGAACTCCGGACAT
CCCTCTTGGTACAGCTCCATCCATGCCAGGCCACAACCCCATGAGACCACCAGCCTTTCT
CCAACAAGGCATGATGGGACCTCACCATCGGATGATGTCACCAGCACAATCTACAATGCC
CGGCCAGCCCACCCTGATGAGCAATCCAGCTGCTGCCGTGGGCATGATTCCTGGCAAGGA
TCGGGGGCCTGCCGGGCTCTACACCCACCCTGGGCCTGTGGGCTCTCCAGGCATGATGAT
GTCCATGCAGGGCATGATGGGACCCCAACAGAACATCATGATCCCCCCACAGATGAGGCC
CCGGGGCATGGCTGCTGACGTGGGCATGGGTGGATTTAGCCAAGGACCTGGCAACCCAGG
AAACATGATGTTTTAAGCTGCTAAGATGGGATGTGCCGATCCTTGTCAAGATGAGATTCC
AGGTCCTGAGAGCTGCTTTGAGGGAGTTCCAGGAGTACTTACTATTGGTCATGCAATAGG
AGAACAGAGACCCGAGGGCTGCTTTGGGGGAGGGGGGAACTCGAGAATGTATGGATTTAC
CTGAAAACAAATTATTCATTTAATCAACAGGTGTGTTTTTTTTAAGATTTATTTTTTAAA
AATTATTTTTGTGGACTTGGGTATCAATGATGGCACCTACTTTTGGGAATCTGTAGCTGT
GCTTTGAGAATTGCCATCGGTCATGTGTTGCACCGTTCTCTGTATGTTTACGTCCTTTGG
ACTGGCTTCTCCCAGGATTCTTTTCTGTTTTTGTTTTTTTGATTTGGGCTTTATTTTTTT
CTGTGTACTGTACTATATTGTAAAAGGGATTTTAGCAGAGACTTTAGTCTTTGGGGCAAG
AGGAGAACAGGAATGCTGGGCTGTTTACTTTAGGTGGAGAATCCATCTTCAGACCTTTGG
ACTATTTTCTTTCAACTGCAGTGTATAGAAAAACCAAACTACGACCTCAGAGCAGAGTAT
TAATGAAAAGCACAAAAAAAGGAACTAAGTTCAGCGAGGGGTGGGGGGAGGGGGGAGATT
TTTCTTTTGAAAAATAATGACTCTTAGGACATTTGTTTTTCAGTTCAAGTGCTCTTCAGC
ACTGTCTTGTCTCCCAATATACCAACCCACTGGCACATTTTTCTCTTGTTTTCTCTCTCC
GATTTTGCTCTGTCTCCTCAGTTAAGTGTTTCCTTCCTTTGTGCCCCCCGCTGGTGACCC
TCTGCTTCCCTCTCTCTTTCCCTTTGGCAGCTGCAATACACAGTGTTATTTTGGGGAAAT
AAATCTAGCAAAGCCTCGCCTTCCATGCCGAGCGTCCTCTTGGCTCTGAGAGGGAAAGGT
CTGTCCTTGGGATGCTCTCTGGTCTTTTTTCCCCCTAAGTCTTTCTCTTTCCCATCATAC
CCTTCCCTGCCCACCTTGTTTTCTGTTCTCCTTTTATTAGGAATTCCCAAGTGAATTTTA
TTAATGTGGGAGTGGAACAGATGCTAAAAGCTATCCAGGATTTTGTTTCTGTTTGTTTTA
AATTTTGTGGTTCCTTCCCTTTCCTCCCCCTCCCATGCGTAAGACGTTCTGTGTAACCTC
CATTAAATTTGGTACAAAACCACTCGCCAGAGCTGTGGTGTCAGAAAAATAAAATATATT
GTTTCTTACAAAA

Protein Sequence

>607 : length: 1426
MHSSNPKVRSSPSGNTQSSPKSKQEVMVRPPTVMSPSGNPQLDSKFSNQGKQGGSASQSQ
PSPCDSKSGGHTPKALPGPGGSMGLKNGAGNGAKGKGKRERSISADSFDQRDPGTPNDDS
DIKECNSADHIKSQDSQHTPHSMTPSNATAPRSSTPSHGQTTATEPTPAQKTPAKVVYVF
STEMANKAAEAVLKGQVETIVSFHIQNISNNKTERSTAPLNTQISALRNDPKPLPQQPPA
PANQDQNSSQNTRLQPTPPIPAPAPKPAAPPRPLDRESPGVENKLIPSVGSPASSTPLPP
DGTGPNSTPNNRAVTPVSQGSNSSSADPKAPPPPPVSSGEPPTLGENPDGLSQEQLEHRE
RSLQTLRDIQRMLFPDEKEFTGAQSGGPQQNPGVLDGPQKKPEGPIQAMMAQSQSLGKGP
GPRTDVGAPFGPQGHRDVPFSPDEMVPPSMNSQSGTIGPDHLDHMTPEQIAWLKLQQEFY
EEKRRKQEQVVVQQCSLQDMMVHQHGPRGVVRGPPPPYQMTPSEGWAPGGTEPFSDGINM
PHSLPPRGMAPHPNMPGSQMRLPGFAGMINSEMEGPNVPNPASRPGLSGVSWPDDVPKIP
DGRNFPPGQGIFSGPGRGERFPNPQGLSEEMFQQQLAEKQLGLPPGMAMEGIRPSMEMNR
MIPGSQRHMEPGNNPIFPRIPVEGPLSPSRGDFPKGIPPQMGPGRELEFGMVPSGMKGDV
NLNVNMGSNSQMIPQKMREAGAGPEEMLKLRPGGSDMLPAQQKMVPLPFGEHPQQEYGMG
PRPFLPMSQGPGSNSGLRNLREPIGPDQRTNSRLSHMPPLPLNPSSNPTSLNTAPPVQRG
LGRKPLDISVAGSQVHSPGINPLKSPTMHQVQSPMLGSPSGNLKSPQTPSQLAGMLAGPA
AAASIKSPPVLGSAAASPVHLKSPSLPAPSPGWTSSPKPPLQSPGIPPNHKAPLTMASPA
MLGNVESGGPPPPTASQPASVNIPGSLPSSTPYTMPPEPTLSQNPLSIMMSRMSKFAMPS
STPLYHDAIKTVASSDDDSPPARSPNLPSMNNMPGMGINTQNPRISGPNPVVPMPTLSPM
GMTQPLSHSNQMPSPNAVGPNIPPHGVPMGPGLMSHNPIMGHGSQEPPMVPQGRMGFPQG
FPPVQSPPQQVPFPHNGPSGGQGSFPGGMGFPGEGPLGRPSNLPQSSADAALCKPGGPGG
PDSFTVLGNSMPSVFTDPDLQEVIRPGATGIPEFDLSRIIPSEKPSQTLQYFPRGEVPGR
KQPQGPGPGFSHMQGMMGEQAPRMGLALPGMGGPGPVGTPDIPLGTAPSMPGHNPMRPPA
FLQQGMMGPHHRMMSPAQSTMPGQPTLMSNPAAAVGMIPGKDRGPAGLYTHPGPVGSPGM
MMSMQGMMGPQQNIMIPPQMRPRGMAADVGMGGFSQGPGNPGNMMF