ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

60561

Name

RINT1

Synonym

RINT-1;RAD50 interactor 1;RINT1;RAD50 interactor 1

Definition

RAD50-interacting protein 1|hsRINT-1

Position

7q22.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

60561

Links to epithelial mesenchymal transition gene database

60561

Links to ovarian cancer gene database

60561

Links to endometrial cancer gene database

60561

Links to iHOP

60561

Sequence Information

Nucleotide Sequence

>60561 : length: 2990
GGCCGTTCCGACCTCCGGTCAGGAGGGGGAGGAACAGAGCACGGCCGGCGGCTGCACGGG
CAGGGCCTCTCTGGGCTGAGAGGAAGAAACCAGTGAGACATCGAGAGGAAGTCGCTGTGG
CACTCAGTCCTACGGCCTCCGAGGCTGGGTAGTGAGTGTGTCGCTGGCCTTAGCCAGACT
CCACAGGCCACGCTGGCTGCGAATGGAGCCGAGGACTCGCGCGGAGGCGAGATGCTACCA
GCCGGCGAGATCGGCGCCTCTCCTGCAGCCCCGTGCTGCTCTGAAAGTGGTGACGAAAGG
AAGAACCTCGAGGAGAAAAGTGACATAAATGTTACAGTTCTTATTGGAAGTAAACAAGTC
AGTGAAGGTACAGATAATGGTGATCTCCCTTCTTATGTGTCTGCATTCATAGAAAAGGAA
GTTGGAAATGACCTTAAATCTTTAAAGAAACTTGATAAACTCATAGAACAGAGGACAGTA
AGTAAAATGCAGTTAGAAGAACAGGTACTTACAATTTCATCAGAAATTCCTAAAAGAATT
CGAAGTGCCTTAAAAAATGCAGAAGAATCAAAGCAATTTCTTAATCAGTTTCTGGAGCAG
GAAACTCATCTCTTCAGCGCCATTAACAGCCATTTGCTGACTGCGCAACCTTGGATGGAC
GATCTTGGAACCATGATTAGCCAGATTGAAGAGATCGAACGTCATCTTGCTTACCTTAAA
TGGATTTCACAAATTGAAGAACTAAGTGATAACATTCAGCAATATCTGATGACCAATAAT
GTACCGGAGGCAGCCTCCACTCTAGTGTCTATGGCAGAACTTGACATTAAACTTCAGGAA
TCATCTTGTACTCATCTTCTTGGTTTCATGAGAGCCACAGTTAAATTCTGGCATAAAATT
CTCAAGGACAAGCTTACAAGTGATTTTGAGGAAATTTTAGCACAGCTTCATTGGCCATTC
ATCGCACCCCCTCAATCACAAACTGTTGGCTTAAGTCGACCTGCCAGTGCCCCGGAGATA
TACAGTTACCTGGAGACACTGTTTTGTCAGCTTTTGAAACTACAAACCTCAGATGAATTA
CTTACTGAGCCAAAGCAACTCCCAGAAAAATACTCTCTTCCTGCCTCCCCTTCTGTCATC
CTGCCCATCCAGGTTATGCTGACTCCTCTTCAGAAGAGGTTCAGGTATCACTTCAGAGGG
AACCGGCAGACTAATGTGTTAAGCAAGCCAGAATGGTACTTGGCTCAAGTACTTATGTGG
ATTGGAAACCATACTGAATTTCTGGATGAGAAGATTCAGCCAATATTAGACAAAGTAGGC
TCTTTGGTAAACGCAAGGCTTGAATTTTCTCGGGGCCTTATGATGCTGGTTCTTGAGAAG
TTAGCCACTGATATTCCTTGTCTGCTATATGATGACAATCTCTTCTGTCATTTGGTGGAT
GAAGTACTCTTGTTTGAAAGGGAGCTACACAGTGTTCATGGCTATCCTGGCACTTTTGCT
AGTTGTATGCATATTCTATCAGAGGAAACCTGTTTTCAGAGATGGTTGACGGTGGAGAGA
AAATTTGCTCTTCAAAAAATGGACTCAATGCTTTCCTCAGAAGCTGCCTGGGTATCGCAA
TATAAGGATATCACTGACGTGGATGAAATGAAAGTTCCAGATTGTGCAGAAACTTTTATG
ACTCTACTCTTGGTTATAACTGACAGGTATAAAAATCTTCCCACAGCTTCCCGAAAGCTT
CAGTTCCTGGAGTTACAGAAGGACTTAGTAGATGATTTTAGGATACGATTAACACAAGTG
ATGAAAGAAGAGACTAGAGCTTCCCTTGGCTTTCGATACTGTGCAATTCTTAATGCTGTG
AACTACATCTCAACAGTACTAGCAGATTGGGCTGACAATGTTTTCTTTCTACAACTTCAA
CAGGCTGCACTGGAGGTGTTTGCAGAGAATAATACTCTGAGTAAATTGCAGCTAGGACAG
CTAGCCTCTATGGAGAGCTCTGTCTTTGATGACATGATTAACCTCTTAGAACGTTTAAAG
CATGATATGTTGACCCGTCAAGTAGACCACGTTTTTAGAGAAGTTAAAGATGCTGCAAAA
TTGTATAAAAAAGAAAGATGGTTGTCCTTGCCATCTCAGTCAGAGCAGGCAGTGATGTCC
CTGTCCAGTTCGGCTTGCCCGTTGCTGCTGACGTTACGAGACCATTTACTTCAGTTGGAG
CAGCAGCTTTGTTTCTCCTTATTTAAAATTTTCTGGCAAATGCTTGTAGAGAAGCTGGAT
GTATACATCTACCAAGAAATAATTCTTGCTAATCACTTCAATGAAGGAGGAGCAGCCCAG
CTGCAGTTTGATATGACTCGGAATCTTTTCCCTTTGTTTTCTCACTATTGCAAGAGACCA
GAAAATTATTTTAAACATATAAAAGAAGCCTGTATTGTTTTGAATTTGAACGTCGGTTCT
GCACTACTGCTGAAAGATGTACTGCAGTCAGCTTCAGGGCAGCTTCCTGCCACAGCAGCA
TTAAATGAAGTTGGAATTTACAAACTGGCTCAACAAGATGTTGAGATTCTACTTAATTTG
AGGACAAATTGGCCTAATACTGGAAAATAATGTCTTTCAGAAAAAGGTTTCTTTGGTTTT
TGTTTCTAAGAAAGAGGAAGCCAATTGGATTTCAAGTTATATGATGAAATTCTGAATTAA
TGAAACTGGAAAACTTTATAGAATTACTTATTATCTTGGATTTATGGTGTTATTAAAATG
CTGACCATATTTCCTTCATCCTCTTGTTCCTAAGGAAACAAAAACAGAAAACGAAACAAT
GAAAACTCAATTCTATTTACAAGTATAAATGCTGAGTATGTCTGTTGAAGACGAGCAGAG
ATATTAAATTATAACCAACTTTCAATTTCCTGTGCTAATTAAGGGAAATTCTGTTGTGGA
TAATCAAACATAGCCAATAAATTTTTTTAAAACTCCAAAAAAAAAAAAAA

Protein Sequence

>60561 : length: 792
MLPAGEIGASPAAPCCSESGDERKNLEEKSDINVTVLIGSKQVSEGTDNGDLPSYVSAFI
EKEVGNDLKSLKKLDKLIEQRTVSKMQLEEQVLTISSEIPKRIRSALKNAEESKQFLNQF
LEQETHLFSAINSHLLTAQPWMDDLGTMISQIEEIERHLAYLKWISQIEELSDNIQQYLM
TNNVPEAASTLVSMAELDIKLQESSCTHLLGFMRATVKFWHKILKDKLTSDFEEILAQLH
WPFIAPPQSQTVGLSRPASAPEIYSYLETLFCQLLKLQTSDELLTEPKQLPEKYSLPASP
SVILPIQVMLTPLQKRFRYHFRGNRQTNVLSKPEWYLAQVLMWIGNHTEFLDEKIQPILD
KVGSLVNARLEFSRGLMMLVLEKLATDIPCLLYDDNLFCHLVDEVLLFERELHSVHGYPG
TFASCMHILSEETCFQRWLTVERKFALQKMDSMLSSEAAWVSQYKDITDVDEMKVPDCAE
TFMTLLLVITDRYKNLPTASRKLQFLELQKDLVDDFRIRLTQVMKEETRASLGFRYCAIL
NAVNYISTVLADWADNVFFLQLQQAALEVFAENNTLSKLQLGQLASMESSVFDDMINLLE
RLKHDMLTRQVDHVFREVKDAAKLYKKERWLSLPSQSEQAVMSLSSSACPLLLTLRDHLL
QLEQQLCFSLFKIFWQMLVEKLDVYIYQEIILANHFNEGGAAQLQFDMTRNLFPLFSHYC
KRPENYFKHIKEACIVLNLNVGSALLLKDVLQSASGQLPATAALNEVGIYKLAQQDVEIL
LNLRTNWPNTGK