ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

604

Name

BCL6

Synonym

BCL5|BCL6A|LAZ3|ZBTB27|ZNF51;B-cell CLL/lymphoma 6;BCL6;B-cell CLL/lymphoma 6

Definition

B-cell lymphoma 5 protein|B-cell lymphoma 6 protein|B-cell lymphoma 6 protein transcript|BCL-5|BCL-6|cys-his2 zinc finger transcription factor|lymphoma-associated zinc finger gene on chromosome 3|protein LAZ-3|zinc finger and BTB domain-containing protein

Position

3q27

Gene Type

protein-coding

Pathways and Diseases

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

Signaling events mediated by HDAC Class II;PID Curated;200019

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

FoxO family signaling;PID Curated;200091

Disease

Hairy-cell leukemia;KEGG DISEASE;H00006

Disease

Lymphoma, B-cell;OMIM

Disease

follicle center lymphoma;GAD

Disease

Stomach disease;FunDO

Disease

follicular lymphoma;GAD

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

lymphoma, follicle center;GAD

Disease

CANCER;GAD

Disease

Cancers;KEGG DISEASE

Disease

Otitis media;FunDO

Disease

Cancer;FunDO

Disease

Waldenstrom macroglobulinaemia;GAD

Disease

Lymphoproliferative disorder;FunDO

External Links

Links to cell senescence gene database

604

Links to epithelial mesenchymal transition gene database

604

Links to ovarian cancer gene database

604

Links to endometrial cancer gene database

604

Links to iHOP

604

Sequence Information

Nucleotide Sequence

>604 : length: 6910
TGAAACCAGCTCCAGATACCGCGTTGTGGTTGCTAGAGGCGGGAGCATCGGGAGGAACGG
AATTACATACACTAAATTAAATGTTTTCTAGCTTTGCTTTTAGAGGCAATCACACCCCCA
ACCCTCGCCCCCACCAGACAGAAAATAAAGAGGGGCGGGTAGGGATCGGTGTGGAAGCTG
CGGCCGCGCGGCGATTCTCGGACGGGCTGGCCTGCCACCTAGCGGTGGGCTGAGATCGAG
TTCGCGGCCATGGGCGGTGGGCTCGCCGTTCCACCTCCCGGGCGGCGGTACCCTGACCAG
ATGCTAGGACTGACAGAAGGAGGGCACCCTCCAATGGGGATGGCATACAACCTCCAAAGT
TTTGGCAAGAGGGATGAAAATCAGAAAGGCCTCGCTGCTTGCCCATCACTCAGCGATGAG
CATCTATTTGCACTAAGAAAAACCACAAATAACCCGCTTCGAACACACCATCTTCCTGTC
CCTGTGGCCCCTCTTAGGGGAAGTCGGTAGTGGAAGGATGCCACCTAGGAGCTCAGGGGC
TTTGGGACGTACAACTCTGTTTTGCAGTTGAGGAAACAGGCCCGACGAGGAGGCTTGTTA
GTGGTGAGTTAGTGACTTAACCAGGACCAGATTTTAAGCTTCTGAATTTCATGTCAGTGA
CTGAAAGCCAAAGGCGGGTTTATCTCAGCTCCTTAGAAGTATTTATGAGAAAGGAGCGGC
TGCCAGAACCATGAGTTTAACCTCTTAGGTCACCTTTGTTGCCAGTGTTCATTGGAAACC
GCTCCCCAGCAGTCTTGGAGGATTTTTTTTAAAGAAAATATGGCCTAAGATTTTCGGTAA
TGACACGAAAAGCCCAGATGGTGCTGAAGGGTGTGGGTCTCGGAGCTCGGGGGTTTGCGT
GTTAAGAGGGGGGTTAAGGCCTGGACCAAAGACTTGCAGGGCGAGCCTCGATTCTGAAAT
CGCTCTCTTCCCCTTCCTAACATCCTCTGCATAGTAGCCTGGCGAGAAACCGGGTGTGTG
TGTGTGAGGGGGTGGGGGTCATGTGGATAGGCCAGAATTTGTGCCACAACAGTTCCTCCG
TAAAGTTTTCTTTCTCCGAGCTCGTGACTTAAGATGGCAAACGCGCGTCCGCATGCTGGC
GGCCCCTAGCGGCAGCAGGCGCGCTCTGCAGGGGGAGACAGCGCCGTCGCCCCCGCCCGG
GTCGGCGGGGATCGAGTTCGGCCCCTCCCACTGCGGGAGCCGTCGGAGGCCGCGTCGGAG
AAACGCGCCTCTGTTCGGACTGGAAACGAATCTGGGAACGAGTTTGAAGCGCGGTCAAGT
TTGACTCATCGCTTTCCAAGGACAGTTAGTGCCTTCCATCTTCATTAACGTGAATAAGGA
CCTTGGCTGACTTCTTTCCAGATCGGATTTTTAAAGGCATTGTTTGCTTGAGGAGATCAT
GCTTCTCCCCTCCCCCGCCAGCCTTTTTGCAAAGGCTGAGCCCAGTCCAGCCAGGACGGC
CGAGGGATCTCTGCTCCGGGACGCGATTTGCTGGCATTGTCTTCGGGCCCTTCTGGAAGG
CTGTCTCGCGCTGAGCGTATGGGGAACGTCCCTTCTGCAACTCCTCTTCAGATCTTGATG
ATAAAACACATCCCTCTGTTTTATTGCATTTCCTAGAAGCTTGCAGGCTTGCAAGAGCAC
TGTTGGCAGGAAACGTGATAGAAATGAAAGTCAGGACACAATGTCCCCGAACACCTCGGT
TATCCAAAGCGGCTGTCGAGGCCATCGCGTTATCAAATTCGCTTTTATTTACTGTCGTCT
CCTGCACCCTCCCGTTCCCCAGCCAAGAGGGCGAAGAGTGTTTTCCCCCAAGAATAAAAA
CAGCTCCGCGATTTGACCTCACCCCCTGCCGCCGGACCACGGTGGTGTCTGCAGCCGTGC
AGCTAGTTGGCTGAAACACTGCTGAGACCGGGAGCCCCACGGCAGGGCCCCTGATGCGGG
GTTCACTACGGCAGTTGCAGCCTTATTAAAATTCCTTGTCCTTGTCCCTAAACAGTGCTT
TACACTTTCAGATTTCCCTTTGGATTTTTCAGCGGGTTATTGGAGTTATTAGATTACCAA
TAATCCAACAGCCTCTGTAGCCTCTCTGGCTGGAGAGGAGGGGGGAAGGGCGGAAGGCAT
TCTCCAAATCGGGAGGCTCTGGCCAAACTAGGTCAATGGGAAGGAGGGGAGGGGCGAGAA
AGGGGTTGACGGTTTCAAACCTTGATGGAGGGCTCTCTCTAGCGTTAGGCAGCGGTAAAA
ACACCATTCGGTTTGAGCTCCCGGAACCACGGGACTCCTAATTTCCAATAAATGCACTTA
CTTCATTTTAACTTCCCAGATTCTCATCCCTACCCCTTATTAAATCCCAACCGTCTCTTT
CACCTTTATCCCACCGGGCGAAGGGGTGAGAAAGCCTCAATGTAGGATTTTGAGGCCAAA
GGCTCGTTCTTTGCAGACCGACTCTGACCCTTCCGCTTGCCGCAGAAGGGATGAGCGGCG
CAGTGTGACGCCACTGGCTAGTTTTAGGACCAGACTGCGGCCTTTGTGGCTGAGTCTTTC
GCTGTCCCCTAGCCCCCGAAAGCGCACCCCGGAGCCTGCTACCGAGACCAATTAGGACAT
GGCACCCGGGGGTTATAATTCCCGGGAGGGCCACAGGAAGGCGAGGCAACTTTGGAGAGT
GCCAGTGCGCGCGCAGGGGTCGGGGCCCCGGCCTTTGCCGAGTCCAAGCTGTGTCTCTAC
GGTTTCGGGGAAATCGGATTCGGAAATCCTTACGGCTTGGCAGCTCCTGTTCTAAAGACT
TTGGGCGGAAACCAAGTGGAGCTGGGTTCCCGTTCTTGCCAACGTAGGCGGAAGGGGCTT
TCTGTTTAGTTTTTCTCCAACCTTGCCTGGGGCGCCTATGATGGAGACCCTCAGCCCCTA
GGGACTCCATCTTTTGACCTTGAAGTCTCGCTCAAACATTCCCCTAAAAGAACGGGGGTG
AGGGAGAATGGAAGGCAAAAAGAGGGAAAAAAGCAAATAAACTTCGGAATCGGACAACTT
AAAGTCTCGATATGAGCCTCGGATTGTATTCGAACTCCTGGGTTCTAGACCCAGCTCTGC
TACTAACTTGTCTGACCTTCCCCATTTATAAACTGTTGTGGGTGAGAGGTGGGACTAGGT
GAACTCTGAGAGCCCTGCACTCGGCGCGGACGAGGGATTTAGGGGAAAGTGTGCTGTATT
CCCCGCGAGCCTTCCCCAGCGGCCCCGCCTCCCTGGGTGAATCCCCGGCGGCCAGCGCAG
CGCAGGCAGCGATCCTGGCGGCTGCCGGGGCCGGCAGCTTCCTGGAAAGTTACTTCTTGT
TGGAGCCGGCAATAGGCAAAGTGTGTTCTGTGAAATCCGCAGAGCCGAGATTGACTACGT
TCCGGGAATGAGAGGGCTGTGTCATTCCCCTCATTGCCTGCTGCATTGACGGCGTAACAG
GAAAAAAAAAAAAAAAAAAAAAAAGGCATACACACAATGTTAGCTACCGAGGTGCACCAA
AAGTTTTATTTGAATGTAACTAAATTAAGGGCCGCCACGGTCATACCACAAAGCCTCCGT
CGCGCCTTGCGGGGGGCTTCGAGGTGGATCGCCCAGGGGCGGGCAGTCCCTGGAAGACAG
GTTTTGAGCAAAATTTTGGACTGTGAAGCAAGGCATTGGTGAAGACAAAATGGCCTCGCC
GGCTGACAGCTGTATCCAGTTCACCCGCCATGCCAGTGATGTTCTTCTCAACCTTAATCG
TCTCCGGAGTCGAGACATCTTGACTGATGTTGTCATTGTTGTGAGCCGTGAGCAGTTTAG
AGCCCATAAAACGGTCCTCATGGCCTGCAGTGGCCTGTTCTATAGCATCTTTACAGACCA
GTTGAAATGCAACCTTAGTGTGATCAATCTAGATCCTGAGATCAACCCTGAGGGATTCTG
CATCCTCCTGGACTTCATGTACACATCTCGGCTCAATTTGCGGGAGGGCAACATCATGGC
TGTGATGGCCACGGCTATGTACCTGCAGATGGAGCATGTTGTGGACACTTGCCGGAAGTT
TATTAAGGCCAGTGAAGCAGAGATGGTTTCTGCCATCAAGCCTCCTCGTGAAGAGTTCCT
CAACAGCCGGATGCTGATGCCCCAAGACATCATGGCCTATCGGGGTCGTGAGGTGGTGGA
GAACAACCTGCCACTGAGGAGCGCCCCTGGGTGTGAGAGCAGAGCCTTTGCCCCCAGCCT
GTACAGTGGCCTGTCCACACCGCCAGCCTCTTATTCCATGTACAGCCACCTCCCTGTCAG
CAGCCTCCTCTTCTCCGATGAGGAGTTTCGGGATGTCCGGATGCCTGTGGCCAACCCCTT
CCCCAAGGAGCGGGCACTCCCATGTGATAGTGCCAGGCCAGTCCCTGGTGAGTACAGCCG
GCCGACTTTGGAGGTGTCCCCCAATGTGTGCCACAGCAATATCTATTCACCCAAGGAAAC
AATCCCAGAAGAGGCACGAAGTGATATGCACTACAGTGTGGCTGAGGGCCTCAAACCTGC
TGCCCCCTCAGCCCGAAATGCCCCCTACTTCCCTTGTGACAAGGCCAGCAAAGAAGAAGA
GAGACCCTCCTCGGAAGATGAGATTGCCCTGCATTTCGAGCCCCCCAATGCACCCCTGAA
CCGGAAGGGTCTGGTTAGTCCACAGAGCCCCCAGAAATCTGACTGCCAGCCCAACTCGCC
CACAGAGTCCTGCAGCAGTAAGAATGCCTGCATCCTCCAGGCTTCTGGCTCCCCTCCAGC
CAAGAGCCCCACTGACCCCAAAGCCTGCAACTGGAAGAAATACAAGTTCATCGTGCTCAA
CAGCCTCAACCAGAATGCCAAACCAGAGGGGCCTGAGCAGGCTGAGCTGGGCCGCCTTTC
CCCACGAGCCTACACGGCCCCACCTGCCTGCCAGCCACCCATGGAGCCTGAGAACCTTGA
CCTCCAGTCCCCAACCAAGCTGAGTGCCAGCGGGGAGGACTCCACCATCCCACAAGCCAG
CCGGCTCAATAACATCGTTAACAGGTCCATGACGGGCTCTCCCCGCAGCAGCAGCGAGAG
CCACTCACCACTCTACATGCACCCCCCGAAGTGCACGTCCTGCGGCTCTCAGTCCCCACA
GCATGCAGAGATGTGCCTCCACACCGCTGGCCCCACGTTCCCTGAGGAGATGGGAGAGAC
CCAGTCTGAGTACTCAGATTCTAGCTGTGAGAACGGGGCCTTCTTCTGCAATGAGTGTGA
CTGCCGCTTCTCTGAGGAGGCCTCACTCAAGAGGCACACGCTGCAGACCCACAGTGACAA
ACCCTACAAGTGTGACCGCTGCCAGGCCTCCTTCCGCTACAAGGGCAACCTCGCCAGCCA
CAAGACCGTCCATACCGGTGAGAAACCCTATCGTTGCAACATCTGTGGGGCCCAGTTCAA
CCGGCCAGCCAACCTGAAAACCCACACTCGAATTCACTCTGGAGAGAAGCCCTACAAATG
CGAAACCTGCGGAGCCAGATTTGTACAGGTGGCCCACCTCCGTGCCCATGTGCTTATCCA
CACTGGTGAGAAGCCCTATCCCTGTGAAATCTGTGGCACCCGTTTCCGGCACCTTCAGAC
TCTGAAGAGCCACCTGCGAATCCACACAGGAGAGAAACCTTACCATTGTGAGAAGTGTAA
CCTGCATTTCCGTCACAAAAGCCAGCTGCGACTTCACTTGCGCCAGAAGCATGGCGCCAT
CACCAACACCAAGGTGCAATACCGCGTGTCAGCCACTGACCTGCCTCCGGAGCTCCCCAA
AGCCTGCTGAAGCATGGAGTGTTGATGCTTTCGTCTCCAGCCCCTTCTCAGAATCTACCC
AAAGGATACTGTAACACTTTACAATGTTCATCCCATGATGTAGTGCCTCTTTCATCCACT
AGTGCAAATCATAGCTGGGGGTTGGGGGTGGTGGGGGTCGGGGCCTGGGGGACTGGGAGC
CGCAGCAGCTCCCCCTCCCCCACTGCCATAAAACATTAAGAAAATCATATTGCTTCTTCT
CCTATGTGTAAGGTGAACCATGTCAGCAAAAAGCAAAATCATTTTATATGTCAAAGCAGG
GGAGTATGCAAAAGTTCTGACTTGACTTTAGTCTGCAAAATGAGGAATGTATATGTTTTG
TGGGAACAGATGTTTCTTTTGTATGTAAATGTGCATTCTTTTAAAAGACAAGACTTCAGT
ATGTTGTCAAAGAGAGGGCTTTAATTTTTTTAACCAAAGGTGAAGGAATATATGGCAGAG
TTGTAAATATATAAATATATATATATATAAAATAAATATATATAAACCTAAAAAAGATAT
ATTAAAAATATAAAACTGCGTTAAAGGCTCGATTTTGTATCTGCAGGCAGACACGGATCT
GAGAATCTTTATTGAGAAAGAGCACTTAAGAGAATATTTTAAGTATTGCATCTGTATAAG
TAAGAAAATATTTTGTCTAAAATGCCTCAGTGTATTTGTATTTTTTTGCAAGTGAAGGTT
TACAATTTACAAAGTGTGTATTAAAAAAAACAAAAAGAACAAAAAAATCTGCAGAAGGAA
AAATGTGTAATTTTGTTCTAGTTTTCAGTTTGTATATACCCGTACAACGTGTCCTCACGG
TGCCTTTTTTCACGGAAGTTTTCAATGATGGGCGAGCGTGCACCATCCCTTTTTGAAGTG
TAGGCAGACACAGGGACTTGAAGTTGTTACTAACTAAACTCTCTTTGGGAATGTTTGTCT
CATCCCATTCTGCGTCATGCTTGTGTTATAACTACTCCGGAGACAGGGTTTGGCTGTGTC
TAAACTGCATTACCGCGTTGTAAAATATAGCTGTACAAATATAAGAATAAAATGTTGAAA
AGTCAAACTG

Protein Sequence

>604 : length: 706
MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSI
FTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDT
CRKFIKASEAEMVSAIKPPREEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAF
APSLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVRMPVANPFPKERALPCDSARPVPG
EYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKAS
KEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASG
SPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEP
ENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGS
QSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQT
HSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEK
PYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHC
EKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPPELPKAC