ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

602

Name

BCL3

Synonym

BCL4|D19S37;B-cell CLL/lymphoma 3;BCL3;B-cell CLL/lymphoma 3

Definition

B-cell leukemia/lymphoma 3|B-cell lymphoma 3 protein|B-cell lymphoma 3-encoded protein|BCL-3|chronic lymphatic leukemia protein|proto-oncogene BCL3

Position

19q13.1-q13.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Atypical NF-kappaB pathway;PID Curated;200017

Disease

cleft lip with cleft palate cleft lip without cleft palate cleft palate;GAD

Disease

Hodgkin's disease;FunDO

Disease

Leukemia/lymphoma, B-cell, 3;OMIM

Disease

Lymphoma;FunDO

Disease

cleft lip with cleft palate;GAD

Disease

cleft lip without cleft palate;GAD

Disease

DEVELOPMENTAL;GAD

External Links

Links to cell senescence gene database

602

Links to epithelial mesenchymal transition gene database

602

Links to ovarian cancer gene database

602

Links to endometrial cancer gene database

602

Links to iHOP

602

Sequence Information

Nucleotide Sequence

>602 : length: 2034
CCCTGCCCCGGGTGCGTCTCTTCACTCCCACTAAGGAGGAAACGGCTCAGAGAGGGGAAG
TGTTTGGCCAAGGTCACCCAGCGATTCAGCCGGCTGCAGGGGAAGTCCCGGCGCCCGGCG
AAACCACCCTCCCGTGCAGCCGAGCCCAGCCGCTCTCCGGCCGCCGTCCCCGGCGGCCCC
ATGCCCCGATGCCCCGCGGGGGCCATGGACGAGGGGCCCGTGGACCTGCGCACCCGGCCC
AAGGCCGCCGGACTCCCGGGCGCCGCGCTGCCGCTCCGCAAGCGCCCGCTGCGCGCGCCC
TCCCCGGAGCCCGCCGCTCCCCGCGGCGCTGCGGGCCTTGTCGTCCCCCTGGACCCTCTG
CGCGGCGGCTGCGACCTGCCGGCGGTCCCCGGGCCCCCCCACGGCCTGGCCCGGCCGGAG
GCGCTTTACTACCCCGGAGCCTTACTGCCTTTGTACCCCACTCGGGCCATGGGCTCCCCG
TTTCCTCTGGTGAACCTGCCTACACCCCTATACCCCATGATGTGCCCCATGGAACACCCC
CTTTCTGCTGACATCGCCATGGCCACCCGTGCAGATGAGGACGGAGACACGCCTCTCCAT
ATTGCTGTGGTGCAGGGTAACCTGCCAGCTGTGCACCGGCTGGTCAACCTCTTCCAGCAG
GGGGGCCGGGAGCTCGACATCTACAACAACCTACGGCAGACACCGCTCCACCTGGCTGTG
ATCACCACATTACCGTCTGTGGTCCGGCTCCTGGTGACAGCTGGTGCCAGCCCCATGGCG
CTGGACCGCCATGGCCAGACGGCCGCTCACCTGGCGTGCGAGCACCGCAGCCCGACCTGC
CTGCGAGCCCTGCTGGACAGCGCAGCTCCGGGCACGTTGGACCTGGAGGCCCGCAATTAT
GACGGGCTCACCGCCCTGCACGTGGCAGTGAACACCGAGTGCCAAGAAACCGTGCAGCTC
TTGCTAGAGCGCGGTGCCGACATCGACGCAGTGGACATTAAGAGCGGCCGCTCCCCGCTC
ATCCACGCCGTGGAAAACAACAGCCTTAGCATGGTGCAGCTGCTGCTGCAGCACGGCGCC
AACGTGAACGCGCAAATGTACTCCGGCAGCTCCGCCCTGCACTCAGCGTCCGGCCGCGGG
CTCCTCCCGCTGGTGCGCACGCTGGTCCGCAGCGGCGCTGACAGCAGCCTCAAGAACTGC
CACAACGACACGCCGCTCATGGTGGCGCGCAGCCGCAGGGTGAGCCGGGGCAGCTGTGGA
CATGCCCCTTGCACACGTGTGTCCGCGGGCTGGTTGCAGGTCATCGACATCCTGAGGGGG
AAGGCCACCCGGCCTGCTTCCACCTCCCAGCCAGACCCCTCCCCTGACCGGAGCGCCAAC
ACCTCCCCCGAGAGCAGCAGCCGCCTCAGCTCCAATGGTCTTCTCTCCGCATCACCATCC
TCCTCACCCTCCCAGTCTCCCCCCAGGGACCCCCCTGGATTCCCCATGGCTCCTCCCAAT
TTCTTCCTTCCTTCCCCATCTCCACCCGCCTTCCTGCCCTTTGCTGGGGTCCTCCGAGGC
CCTGGCCGGCCGGTGCCCCCCTCCCCAGCTCCAGGAGGCAGCTGAGGGGGATGGGGGGGC
AGATCTTGGACTCATGAGGAGGGGCCCCCCTGCCCTGTGGGGTCAACCCTTCTGGAAACT
GTGAAGATCTCACTCTGCCCCCCCCCCCCATCTTCGGGACCAGGATTTGCACAGAAGCAC
ATGCACCTACCCATACACCCCCTCTTCTGAGCACAGATGTTCCCCCATCTCGCTCCCTCC
CAGGACTCTGACCCCAGCATTCTCAGGCACCAGTCCCTGTCCGGAATGCCACCCACATCT
TCCATTTCCATGTCCCCTCCCAGAGCTGGTGGACCCAGGGAACAGCCACTCCCCTCCACT
CTCTACCAGATAACTGAGGAGGGGAGAGGTGGGCCGTAACGGGCACGGATCACGATGTAA
ATTATTAAGCATTTTGGTTGGATTTCTTTTGTAATAAACTATTTTTGTACCATA

Protein Sequence

>602 : length: 474
MPRCPAGAMDEGPVDLRTRPKAAGLPGAALPLRKRPLRAPSPEPAAPRGAAGLVVPLDPL
RGGCDLPAVPGPPHGLARPEALYYPGALLPLYPTRAMGSPFPLVNLPTPLYPMMCPMEHP
LSADIAMATRADEDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAV
ITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNY
DGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGA
NVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVSRGSCG
HAPCTRVSAGWLQVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPS
SSPSQSPPRDPPGFPMAPPNFFLPSPSPPAFLPFAGVLRGPGRPVPPSPAPGGS