ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

6015

Name

RING1

Synonym

RING1A|RNF1;ring finger protein 1;RING1;ring finger protein 1

Definition

E3 ubiquitin-protein ligase RING1|polycomb complex protein RING1|really interesting new gene 1 protein

Position

6p21.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

the prc2 complex sets long-term gene silencing through modification of histone tails;PID BioCarta;100063

Disease

Prostate cancer;FunDO

External Links

Links to cell senescence gene database

6015

Links to epithelial mesenchymal transition gene database

6015

Links to ovarian cancer gene database

6015

Links to endometrial cancer gene database

6015

Links to iHOP

6015

Sequence Information

Nucleotide Sequence

>6015 : length: 1744
CAGCGCCCGGGCCATGGCGGCGGCGGTGGCGGGAGCTGCTGTCTGAGCAGCGGTTGCGGA
CCGAGCGAACTTGGCCCAGGAGCCCGGGCCTAGGGAGAGGCGCGGCGGCGGCGGGAGCGC
GAACGGCTGGAGCTGGCCTTCTTCGCCTTCTCCTCGGCTGTGGAGCCCTGGTGGGGGGTC
TGCGCCCGGTCACCATGACGACGCCGGCGAATGCCCAGAATGCCAGCAAAACGTGGGAAC
TGAGTCTGTATGAGCTGCACCGGACCCCGCAGGAAGCCATAATGGATGGCACAGAGATTG
CTGTTTCCCCTCGGTCACTGCATTCAGAACTCATGTGCCCTATCTGCCTGGACATGCTGA
AGAATACGATGACCACCAAGGAGTGCCTCCACAGATTCTGCTCTGACTGCATTGTCACAG
CCCTACGGAGCGGGAACAAGGAGTGTCCTACCTGCCGAAAGAAGCTGGTGTCCAAGCGAT
CCCTACGGCCAGACCCCAACTTTGATGCCCTGATCTCTAAGATCTATCCTAGCCGGGAGG
AATACGAGGCCCATCAAGACCGAGTGCTTATCCGCCTGAGCCGCCTGCACAACCAGCAGG
CATTGAGCTCCAGCATTGAGGAGGGGCTACGCATGCAGGCCATGCACAGGGCCCAGCGTG
TGAGGCGGCCGATACCAGGGTCAGATCAGACCACAACGATGAGTGGGGGGGAAGGAGAGC
CCGGGGAGGGAGAAGGGGATGGAGAAGATGTGAGCTCAGACTCCGCCCCTGACTCTGCCC
CAGGCCCTGCTCCCAAGCGACCCCGTGGAGGGGGCGCAGGGGGGAGCAGTGTAGGGACAG
GGGGAGGCGGCACTGGTGGGGTGGGTGGGGGTGCCGGTTCGGAAGACTCTGGTGACCGGG
GAGGGACTCTGGGAGGGGGAACGCTGGGCCCCCCAAGCCCTCCTGGGGCCCCCAGCCCCC
CAGAGCCAGGTGGAGAAATTGAGCTCGTGTTCCGGCCCCACCCCCTGCTCGTGGAGAAGG
GAGAATACTGCCAGACGAGGTATGTGAAGACAACTGGGAATGCCACAGTGGACCACCTCT
CCAAGTACTTGGCCCTGCGCATTGCCCTCGAGCGGAGGCAACAGCAGGAAGCAGGGGAGC
CAGGAGGGCCTGGAGGGGGCGCCTCTGACACCGGAGGACCTGATGGGTGTGGCGGGGAGG
GTGGGGGTGCCGGAGGAGGTGACGGTCCTGAGGAGCCTGCTTTGCCCAGCCTGGAGGGCG
TCAGTGAAAAGCAGTACACCATCTACATCGCACCTGGAGGCGGGGCGTTCACGACGTTGA
ATGGCTCGCTGACCCTGGAGCTGGTGAATGAGAAATTCTGGAAGGTGTCCCGGCCACTGG
AGCTGTGCTATGCTCCCACCAAGGATCCAAAGTGACCCCACCAGGGGACAGCCAGAGGAA
GGGGACCATGGGGTATCCCTGTGTCCTGGTCTATCACCCCAGCTTCTTTGTCCCCCAGTA
CCCCCAGCCCAGCCAGCCAATAAGAGGACACAAATGAGGACACGTGGCTTTTATACAAAG
TATCTATATGAGATTCTTCTATATTGTACAGAGTGGGGCAAAACACGCCCCCATCTGCTG
CCTTTTCTATTGCCCTGCAACGTCCCATCTATACGAGGTGTTGGAGAAGGTGAAGAACCC
TCCCATTCACGCCCGCCTACCAACAACAAACGTGCTTTTTTCCTCTTTGAAACCTGCAAA
AAAA

Protein Sequence

>6015 : length: 406
MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMT
TKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAH
QDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGE
GDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAGSEDSGDRGGTLG
GGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLA
LRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQ
YTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK