ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5995

Name

RGR

Synonym

RP44;retinal G protein coupled receptor;RGR;retinal G protein coupled receptor

Definition

RGR-opsin|RPE retinal G-protein coupled receptor|RPE-retinal G protein-coupled receptor

Position

10q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by GPCR;Reactome;REACT:14797

Disease

Retinal disease;FunDO

Disease

Retinitis pigmentosa-44;OMIM

External Links

Links to cell senescence gene database

5995

Links to epithelial mesenchymal transition gene database

5995

Links to ovarian cancer gene database

5995

Links to endometrial cancer gene database

5995

Links to iHOP

5995

Sequence Information

Nucleotide Sequence

>5995 : length: 1596
AACCCGCCGCTCTTGTGGATCTCACTGTCTTTGCTCAAACCTGGAAGGAAGGACATCAAA
AATGAAACCACCTCAAGTCTCTCCCACCTCTGCGGAGCCATGCGATCGATGATCAAGTTG
TTTAAGAGCCAGGACTTGGCAGCCCCACAGCTGGATTCACACCTGGGCTCTTTGCTTGCT
GGCTGTGTGTCCTTGAGTACATTAGCTCTCTCCGGTCTCAGCCTCAATACCCTGACCATC
TTCTCTTTCTGCAAGACCCCGGAGCTGCGGACTCCCTGCCACCTACTGGTGCTGAGCTTG
GCTCTTGCGGACAGTGGGATCAGCCTGAATGCCCTCGTTGCAGCCACATCCAGCCTTCTC
CGGCGCTGGCCCTACGGCTCGGACGGCTGCCAGGCTCACGGCTTCCAGGGCTTTGTGACA
GCGTTGGCCAGCATCTGCAGCAGTGCAGCCATCGCATGGGGGCGTTATCACCACTACTGC
ACCCGTAGCCAGCTGGCCTGGAACTCAGCCGTCTCTCTGGTGCTCTTCGTGTGGCTGTCT
TCTGCCTTCTGGGCAGCTCTGCCCCTTCTGGGTTGGGGTCACTACGACTATGAGCCACTG
GGGACATGCTGCACCCTGGACTACTCCAAGGGGGACAGAAACTTCACCAGCTTCCTCTTC
ACCATGTCCTTCTTCAACTTCGCCATGCCCCTCTTCATCACGATCACTTCCTACAGTCTC
ATGGAGCAGAAACTGGGGAAGAGTGGCCATCTCCAGGTGCCCGCCCTCATTGCCAAAATG
GTGCCCACGATCAATGCCATCAACTATGCCCTGGGCAATGAGATGGTCTGCAGGGGAATC
TGGCAGTGCCTCTCACCGCAGAAGAGGGAGAAGGACCGAACCAAGTGAGCCTGCCACCCT
GGAGTGAGCCCCAGGCCAGGAGGCTGTTCCAGGAGTCCTGCCCAGCAGCCTCAGTGGCCA
AGCCCAGACACTCACCCACCTTCCCCAGTGGCCCCGTGGATCCTGGTCCTAGGCTGGACA
CAGGATTCAGAAAGACACCAGGCTGCACAGAAAGAGCCAGATGGACCTGAGTGTCGGTCA
CAGCCCCCTACACTCAAGGCTGAGAGGCCTCAGGAAAGTCATTCCTTTTTAAAAATAATA
ATAAATGTAAGGGGGTACAGTGCAGTTTTGTTACATGGATAGATTGCCTAGTGGTGAAGT
CTGGGCTTTTAGTGTAACCATCACCCTAATAATATACGTTGTACCCATTAAGTTATTTCT
CATCCCTCACCCCCTCCCACCTTGTCACCCTTCTGAGTCTCCAATGTCTATTATTCCACA
CTCCATGTCCACGTGTACACATTATTTAGCTCCCACTTACAAGTGAGAACATGTGGTATT
TGACTTTCTGTTTTTGAGTTATTTCACTTAAAATAATGACCTCCAGTTTCATCCATGTTG
CTGCAAAAGACATGATCTCGTTCTTTTTTATGGCAGTGTAGTATTCCATTCCATATACAT
ATATAAACGTTATATATATGTAACGTTTTCTTTATCCAATCATCTGTTGATGGATAGATT
CCATATCTTTGCTACTGTAAACAGCTGTGATAAGCA

Protein Sequence

>5995 : length: 295
MAETSALPTGFGELEVLAVGMVLLVEALSGLSLNTLTIFSFCKTPELRTPCHLLVLSLAL
ADSGISLNALVAATSSLLRVSHRRWPYGSDGCQAHGFQGFVTALASICSSAAIAWGRYHH
YCTRSQLAWNSAVSLVLFVWLSSAFWAALPLLGWGHYDYEPLGTCCTLDYSKGDRNFTSF
LFTMSFFNFAMPLFITITSYSLMEQKLGKSGHLQVNTTLPARTLLLGWGPYAILYLYAVI
ADVTSISPKLQMVPALIAKMVPTINAINYALGNEMVCRGIWQCLSPQKREKDRTK