ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

598

Name

BCL2L1

Synonym

BCL-XL/S|BCL2L|BCLX|BCLXL|BCLXS|Bcl-X|PPP1R52|bcl-xL|bcl-xS;BCL2-like 1;BCL2L1;BCL2-like 1

Definition

apoptosis regulator Bcl-X|bcl-2-like protein 1|protein phosphatase 1, regulatory subunit 52

Position

20q11.21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Apoptosis;Reactome;REACT:578

Pathway

il-2 receptor beta chain in t cell activation;PID BioCarta;100129

Pathway

Class I PI3K signaling events mediated by Akt;PID Curated;200169

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

ATF-2 transcription factor network;PID Curated;200116

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

Apoptosis;KEGG PATHWAY;hsa04210

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

EPO signaling pathway;PID Curated;200157

Pathway

BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members;PID Reactome;500890

Pathway

Amyotrophic lateral sclerosis (ALS);KEGG PATHWAY;hsa05014

Pathway

CD40/CD40L signaling;PID Curated;200031

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

IL2 signaling events mediated by STAT5;PID Curated;200158

Pathway

role of mitochondria in apoptotic signaling;PID BioCarta;100106

Pathway

ras signaling pathway;PID BioCarta;100047

Pathway

apoptotic signaling in response to dna damage;PID BioCarta;100204

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

opposing roles of aif in apoptosis and cell survival;PID BioCarta;100249

Pathway

Role of Calcineurin-dependent NFAT signaling in lymphocytes;PID Curated;200076

Pathway

regulation of bad phosphorylation;PID BioCarta;100233

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Disease

Autoimmune disease;FunDO

Disease

Ischemia;FunDO

Disease

Adenovirus infection;FunDO

Disease

Glaucoma;FunDO

Disease

Thyroid gland disease;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Multiple sclerosis;FunDO

Disease

Severe acute respiratory syndrome;FunDO

Disease

Lymphopenia;FunDO

Disease

Cancer;FunDO

Disease

Parkinson disease;FunDO

Disease

Dental plaque;FunDO

Disease

Rabies;FunDO

Disease

Asthma;FunDO

Disease

HIV infection;FunDO

Disease

Neck cancer;FunDO

Disease

Polyarthritis;FunDO

External Links

Links to cell senescence gene database

598

Links to epithelial mesenchymal transition gene database

598

Links to ovarian cancer gene database

598

Links to endometrial cancer gene database

598

Links to iHOP

598

Sequence Information

Nucleotide Sequence

>598 : length: 2734
GATCCGGGCGATGGAGGAGGAAGCAAGCGAGGGGGCTGGTTCCTGAGCTTCGCAATTCCT
GTGTCGCCTTCTGGGCTCCCAGCCTGCCGGGTCGCATGATCCCTCCGGCCGGAGCTGGTT
TTTTTGCCAGCCACCGCGAGGCCGGCTGAGTTACCGGCATCCCCGCAGCCACCTCCTCTC
CCGACCTGTGATACAAAAGATCTTCCGGGGGCTGCACCTGCCTGCCTTTGCCTAAGGCGG
ATTTGAATCTCTTTCTCTCCCTTCAGAATCTTATCTTGGCTTTGGATCTTAGAAGAGAAT
CACTAACCAGAGACGAGACTCAGTGAGTGAGCAGGTGTTTTGGACAATGGACTGGTTGAG
CCCATCCCTATTATAAAAATGTCTCAGAGCAACCGGGAGCTGGTGGTTGACTTTCTCTCC
TACAAGCTTTCCCAGAAAGGATACAGCTGGAGTCAGTTTAGTGATGTGGAAGAGAACAGG
ACTGAGGCCCCAGAAGGGACTGAATCGGAGATGGAGACCCCCAGTGCCATCAATGGCAAC
CCATCCTGGCACCTGGCAGACAGCCCCGCGGTGAATGGAGCCACTGGCCACAGCAGCAGT
TTGGATGCCCGGGAGGTGATCCCCATGGCAGCAGTAAAGCAAGCGCTGAGGGAGGCAGGC
GACGAGTTTGAACTGCGGTACCGGCGGGCATTCAGTGACCTGACATCCCAGCTCCACATC
ACCCCAGGGACAGCATATCAGAGCTTTGAACAGGTAGTGAATGAACTCTTCCGGGATGGG
GTAAACTGGGGTCGCATTGTGGCCTTTTTCTCCTTCGGCGGGGCACTGTGCGTGGAAAGC
GTAGACAAGGAGATGCAGGTATTGGTGAGTCGGATCGCAGCTTGGATGGCCACTTACCTG
AATGACCACCTAGAGCCTTGGATCCAGGAGAACGGCGGCTGGGTGCCAGATGCCAGTTTT
AGATTCTGGCTCCACCACTGACACAGCTGGGTGACCTTGATCCAGTCCCTGGACCCTCAG
AGGCACAGCTTCTTGGCCTGTAAATGGGGAGAGACAGCCTGCATTGCAGAATTGTTGGGA
GGATTAAAGGACAAATTGGGATACTTTTGTGGAACTCTATGGGAACAATGCAGCAGCCGA
GAGCCGAAAGGGCCAGGAACGCTTCAACCGCTGGTTCCTGACGGGCATGACTGTGGCCGG
CGTGGTTCTGCTGGGCTCACTCTTCAGTCGGAAATGACCAGACACTGACCATCCACTCTA
CCCTCCCACCCCCTTCTCTGCTCCACCACATCCTCCGTCCAGCCGCCATTGCCACCAGGA
GAACCACTACATGCAGCCCATGCCCACCTGCCCATCACAGGGTTGGGCCCAGATCTGGTC
CCTTGCAGCTAGTTTTCTAGAATTTATCACACTTCTGTGAGACCCCCACACCTCAGTTCC
CTTGGCCTCAGAATTCACAAAATTTCCACAAAATCTGTCCAAAGGAGGCTGGCAGGTATG
GAAGGGTTTGTGGCTGGGGGCAGGAGGGCCCTACCTGATTGGTGCAACCCTTACCCCTTA
GCCTCCCTGAAAATGTTTTTCTGCCAGGGAGCTTGAAAGTTTTCAGAACCTCTTCCCCAG
AAAGGAGACTAGATTGCCTTTGTTTTGATGTTTGTGGCCTCAGAATTGATCATTTTCCCC
CCACTCTCCCCACACTAACCTGGGTTCCCTTTCCTTCCATCCCTACCCCCTAAGAGCCAT
TTAGGGGCCACTTTTGACTAGGGATTCAGGCTGCTTGGGATAAAGATGCAAGGACCAGGA
CTCCCTCCTCACCTCTGGACTGGCTAGAGTCCTCACTCCCAGTCCAAATGTCCTCCAGAA
GCCTCTGGCTAGAGGCCAGCCCCACCCAGGAGGGAGGGGGCTATAGCTACAGGAAGCACC
CCATGCCAAAGCTAGGGTGGCCCTTGCAGTTCAGCACCACCCTAGTCCCTTCCCCTCCCT
GGCTCCCATGACCATACTGAGGGACCAACTGGGCCCAAGACAGATGCCCCAGAGCTGTTT
ATGGCCTCAGCTGCCTCACTTCCTACAAGAGCAGCCTGTGGCATCTTTGCCTTGGGCTGC
TCCTCATGGTGGGTTCAGGGGACTCAGCCCTGAGGTGAAAGGGAGCTATCAGGAACAGCT
ATGGGAGCCCCAGGGTCTTCCCTACCTCAGGCAGGAAGGGCAGGAAGGAGAGCCTGCTGC
ATGGGGTGGGGTAGGGCTGACTAGAAGGGCCAGTCCTGCCTGGCCAGGCAGATCTGTGCC
CCATGCCTGTCCAGCCTGGGCAGCCAGGCTGCCAAGGCCAGAGTGGCCTGGCCAGGAGCT
CTTCAGGCCTCCCTCTCTCTTCTGCTCCACCCTTGGCCTGTCTCATCCCCAGGGGTCCCA
GCCACCCCGGGCTCTCTGCTGTACATATTTGAGACTAGTTTTTATTCCTTGTGAAGATGA
TATACTATTTTTGTTAAGCGTGTCTGTATTTATGTGTGAGGAGCTGCTGGCTTGCAGTGC
GCGTGCACGTGGAGAGCTGGTGCCCGGAGATTGGACGGCCTGATGCTCCCTCCCCTGCCC
TGGTCCAGGGAAGCTGGCCGAGGGTCCTGGCTCCTGAGGGGCATCTGCCCCTCCCCCAAC
CCCCACCCCACACTTGTTCCAGCTCTTTGAAATAGTCTGTGTGAAGGTGAAAGTGCAGTT
CAGTAATAAACTGTGTTTACTCAGTGAACAAAGA

Protein Sequence

>598 : length: 233
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK