ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5979

Name

RET

Synonym

CDHF12|CDHR16|HSCR1|MEN2A|MEN2B|MTC1|PTC|RET-ELE1|RET51;ret proto-oncogene;RET;ret proto-oncogene

Definition

RET receptor tyrosine kinase|RET transforming sequence|cadherin family member 12|cadherin-related family member 16|hydroxyaryl-protein kinase|proto-oncogene c-Ret|proto-oncogene tyrosine-protein kinase receptor Ret|rearranged during transfection|receptor

Position

10q11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Signaling events regulated by Ret tyrosine kinase;PID Curated;200058

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Disease

Endocrine system disease;FunDO

Disease

Thyroid cancer;KEGG DISEASE;H00032

Disease

Primary hyperparathyroidism;FunDO

Disease

thyroid cancer;GAD

Disease

Cancer;FunDO

Disease

sporadic pheochromocytoma;GAD

Disease

Neck cancer;FunDO

Disease

Medullary thyroid carcinoma;OMIM

Disease

Rheumatoid arthritis;FunDO

Disease

Cancers of endocrine organs;KEGG DISEASE

Disease

Multiple endocrine neoplasia IIA;OMIM

Disease

Pheochromocytoma;OMIM

Disease

Pheochromocytoma;GAD

Disease

Hirschsprung's disease;GAD

Disease

Multiple endocrine neoplasia IIB;OMIM

Disease

Hirschsprung's disease;NHGRI

Disease

Hirschsprung disease;OMIM

Disease

Hirschsprung's disease intestinal neuronal dysplasia;GAD

Disease

C-cell hyperplasia;GAD

Disease

medullary sponge kidney disease;GAD

Disease

Multiple endocrine neoplasia;FunDO

Disease

CANCER;GAD

Disease

Central hypoventilation syndrome, congenital;OMIM

Disease

Cancers;KEGG DISEASE

Disease

Myopathy;FunDO

Disease

Multiple Endocrine Neoplasia Type 2a;GAD

Disease

multiple endocrine neoplasia;GAD

Disease

germline mutations;GAD

Disease

Thyroid gland disease;FunDO

Disease

thyroid carcinoma, sporadic medullary;GAD

Disease

Renal agenesis;OMIM

Disease

ovarian cancer;GAD

Disease

RENAL;GAD

External Links

Links to cell senescence gene database

5979

Links to epithelial mesenchymal transition gene database

5979

Links to ovarian cancer gene database

5979

Links to endometrial cancer gene database

5979

Links to iHOP

5979

Sequence Information

Nucleotide Sequence

>5979 : length: 5629
AGTCCCGCGACCGAAGCAGGGCGCGCAGCAGCGCTGAGTGCCCCGGAACGTGCGTCGCGC
CCCCAGTGTCCGTCGCGTCCGCCGCGCCCCGGGCGGGGATGGGGCGGCCAGACTGAGCGC
CGCACCCGCCATCCAGACCCGCCGGCCCTAGCCGCAGTCCCTCCAGCCGTGGCCCCAGCG
CGCACGGGCGATGGCGAAGGCGACGTCCGGTGCCGCGGGGCTGCGTCTGCTGTTGCTGCT
GCTGCTGCCGCTGCTAGGCAAAGTGGCATTGGGCCTCTACTTCTCGAGGGATGCTTACTG
GGAGAAGCTGTATGTGGACCAGGCGGCCGGCACGCCCTTGCTGTACGTCCATGCCCTGCG
GGACGCCCCTGAGGAGGTGCCCAGCTTCCGCCTGGGCCAGCATCTCTACGGCACGTACCG
CACACGGCTGCATGAGAACAACTGGATCTGCATCCAGGAGGACACCGGCCTCCTCTACCT
TAACCGGAGCCTGGACCATAGCTCCTGGGAGAAGCTCAGTGTCCGCAACCGCGGCTTTCC
CCTGCTCACCGTCTACCTCAAGGTCTTCCTGTCACCCACATCCCTTCGTGAGGGCGAGTG
CCAGTGGCCAGGCTGTGCCCGCGTATACTTCTCCTTCTTCAACACCTCCTTTCCAGCCTG
CAGCTCCCTCAAGCCCCGGGAGCTCTGCTTCCCAGAGACAAGGCCCTCCTTCCGCATTCG
GGAGAACCGACCCCCAGGCACCTTCCACCAGTTCCGCCTGCTGCCTGTGCAGTTCTTGTG
CCCCAACATCAGCGTGGCCTACAGGCTCCTGGAGGGTGAGGGTCTGCCCTTCCGCTGCGC
CCCGGACAGCCTGGAGGTGAGCACGCGCTGGGCCCTGGACCGCGAGCAGCGGGAGAAGTA
CGAGCTGGTGGCCGTGTGCACCGTGCACGCCGGCGCGCGCGAGGAGGTGGTGATGGTGCC
CTTCCCGGTGACCGTGTACGACGAGGACGACTCGGCGCCCACCTTCCCCGCGGGCGTCGA
CACCGCCAGCGCCGTGGTGGAGTTCAAGCGGAAGGAGGACACCGTGGTGGCCACGCTGCG
TGTCTTCGATGCAGACGTGGTACCTGCATCAGGGGAGCTGGTGAGGCGGTACACAAGCAC
GCTGCTCCCCGGGGACACCTGGGCCCAGCAGACCTTCCGGGTGGAACACTGGCCCAACGA
GACCTCGGTCCAGGCCAACGGCAGCTTCGTGCGGGCGACCGTACATGACTATAGGCTGGT
TCTCAACCGGAACCTCTCCATCTCGGAGAACCGCACCATGCAGCTGGCGGTGCTGGTCAA
TGACTCAGACTTCCAGGGCCCAGGAGCGGGCGTCCTCTTGCTCCACTTCAACGTGTCGGT
GCTGCCGGTCAGCCTGCACCTGCCCAGTACCTACTCCCTCTCCGTGAGCAGGAGGGCTCG
CCGATTTGCCCAGATCGGGAAAGTCTGTGTGGAAAACTGCCAGGCATTCAGTGGCATCAA
CGTCCAGTACAAGCTGCATTCCTCTGGTGCCAACTGCAGCACGCTAGGGGTGGTCACCTC
AGCCGAGGACACCTCGGGGATCCTGTTTGTGAATGACACCAAGGCCCTGCGGCGGCCCAA
GTGTGCCGAACTTCACTACATGGTGGTGGCCACCGACCAGCAGACCTCTAGGCAGGCCCA
GGCCCAGCTGCTTGTAACAGTGGAGGGGTCATATGTGGCCGAGGAGGCGGGCTGCCCCCT
GTCCTGTGCAGTCAGCAAGAGACGGCTGGAGTGTGAGGAGTGTGGCGGCCTGGGCTCCCC
AACAGGCAGGTGTGAGTGGAGGCAAGGAGATGGCAAAGGGATCACCAGGAACTTCTCCAC
CTGCTCTCCCAGCACCAAGACCTGCCCCGACGGCCACTGCGATGTTGTGGAGACCCAAGA
CATCAACATTTGCCCTCAGGACTGCCTCCGGGGCAGCATTGTTGGGGGACACGAGCCTGG
GGAGCCCCGGGGGATTAAAGCTGGCTATGGCACCTGCAACTGCTTCCCTGAGGAGGAGAA
GTGCTTCTGCGAGCCCGAAGACATCCAGGATCCACTGTGCGACGAGCTGTGCCGCACGGT
GATCGCAGCCGCTGTCCTCTTCTCCTTCATCGTCTCGGTGCTGCTGTCTGCCTTCTGCAT
CCACTGCTACCACAAGTTTGCCCACAAGCCACCCATCTCCTCAGCTGAGATGACCTTCCG
GAGGCCCGCCCAGGCCTTCCCGGTCAGCTACTCCTCTTCCGGTGCCCGCCGGCCCTCGCT
GGACTCCATGGAGAACCAGGTCTCCGTGGATGCCTTCAAGATCCTGGAGGATCCAAAGTG
GGAATTCCCTCGGAAGAACTTGGTTCTTGGAAAAACTCTAGGAGAAGGCGAATTTGGAAA
AGTGGTCAAGGCAACGGCCTTCCATCTGAAAGGCAGAGCAGGGTACACCACGGTGGCCGT
GAAGATGCTGAAAGAGAACGCCTCCCCGAGTGAGCTTCGAGACCTGCTGTCAGAGTTCAA
CGTCCTGAAGCAGGTCAACCACCCACATGTCATCAAATTGTATGGGGCCTGCAGCCAGGA
TGGCCCGCTCCTCCTCATCGTGGAGTACGCCAAATACGGCTCCCTGCGGGGCTTCCTCCG
CGAGAGCCGCAAAGTGGGGCCTGGCTACCTGGGCAGTGGAGGCAGCCGCAACTCCAGCTC
CCTGGACCACCCGGATGAGCGGGCCCTCACCATGGGCGACCTCATCTCATTTGCCTGGCA
GATCTCACAGGGGATGCAGTATCTGGCCGAGATGAAGCTCGTTCATCGGGACTTGGCAGC
CAGAAACATCCTGGTAGCTGAGGGGCGGAAGATGAAGATTTCGGATTTCGGCTTGTCCCG
AGATGTTTATGAAGAGGATTCCTACGTGAAGAGGAGCCAGGGTCGGATTCCAGTTAAATG
GATGGCAATTGAATCCCTTTTTGATCATATCTACACCACGCAAAGTGATGTATGGTCTTT
TGGTGTCCTGCTGTGGGAGATCGTGACCCTAGGGGGAAACCCCTATCCTGGGATTCCTCC
TGAGCGGCTCTTCAACCTTCTGAAGACCGGCCACCGGATGGAGAGGCCAGACAACTGCAG
CGAGGAGATGTACCGCCTGATGCTGCAATGCTGGAAGCAGGAGCCGGACAAAAGGCCGGT
GTTTGCGGACATCAGCAAAGACCTGGAGAAGATGATGGTTAAGAGGAGAGACTACTTGGA
CCTTGCGGCGTCCACTCCATCTGACTCCCTGATTTATGACGACGGCCTCTCAGAGGAGGA
GACACCGCTGGTGGACTGTAATAATGCCCCCCTCCCTCGAGCCCTCCCTTCCACATGGAT
TGAAAACAAACTCTATGGCATGTCAGACCCGAACTGGCCTGGAGAGAGTCCTGTACCACT
CACGAGAGCTGATGGCACTAACACTGGGTTTCCAAGATATCCAAATGATAGTGTATATGC
TAACTGGATGCTTTCACCCTCAGCGGCAAAATTAATGGACACGTTTGATAGTTAACATTT
CTTTGTGAAAGGTAATGGACTCACAAGGGGAAGAAACATGCTGAGAATGGAAAGTCTACC
GGCCCTTTCTTTGTGAACGTCACATTGGCCGAGCCGTGTTCAGTTCCCAGGTGGCAGACT
CGTTTTTGGTAGTTTGTTTTAACTTCCAAGGTGGTTTTACTTCTGATAGCCGGTGATTTT
CCCTCCTAGCAGACATGCCACACCGGGTAAGAGCTCTGAGTCTTAGTGGTTAAGCATTCC
TTTCTCTTCAGTGCCCAGCAGCACCCAGTGTTGGTCTGTGTCCATCAGTGACCACCAACA
TTCTGTGTTCACATGTGTGGGTCCAACACTTACTACCTGGTGTATGAAATTGGACCTGAA
CTGTTGGATTTTTCTAGTTGCCGCCAAACAAGGCAAAAAAATTTAAACATGAAGCACACA
CACAAAAAAGGCAGTAGGAAAAATGCTGGCCCTGATGACCTGTCCTTATTCAGAATGAGA
GACTGCGGGGGGGGCCTGGGGGTAGTGTCAATGCCCCTCCAGGGCTGGAGGGGAAGAGGG
GCCCCGAGGATGGGCCTGGGCTCAGCATTCGAGATCTTGAGAATGATTTTTTTTTAATCA
TGCAACCTTTCCTTAGGAAGACATTTGGTTTTCATCATGATTAAGATGATTCCTAGATTT
AGCACAATGGAGAGATTCCATGCCATCTTTACTATGTGGATGGTGGTATCAGGGAAGAGG
GCTCACAAGACACATTTGTCCCCCGGGCCCACCACATCATCCTCACGTGTTCGGTACTGA
GCAGCCACTACCCCTGATGAGAACAGTATGAAGAAAGGGGGCTGTTGGAGTCCCAGAATT
GCTGACAGCAGAGGCTTTGCTGCTGTGAATCCCACCTGCCACCAGCCTGCAGCACACCCC
ACAGCCAAGTAGAGGCGAAAGCAGTGGCTCATCCTACCTGTTAGGAGCAGGTAGGGCTTG
TACTCACTTTAATTTGAATCTTATCAACTTACTCATAAAGGGACAGGCTAGCTAGCTGTG
TTAGAAGTAGCAATGACAATGACCAAGGACTGCTACACCTCTGATTACAATTCTGATGTG
AAAAAGATGGTGTTTGGCTCTTATAGAGCCTGTGTGAAAGGCCCATGGATCAGCTCTTCC
TGTGTTTGTAATTTAATGCTGCTACAAGATGTTTCTGTTTCTTAGATTCTGACCATGACT
CATAAGCTTCTTGTCATTCTTCATTGCTTGTTTGTGGTCACAGATGCACAACACTCCTCC
AGTCTTGTGGGGGCAGCTTTTGGGAAGTCTCAGCAGCTCTTCTGGCTGTGTTGTCAGCAC
TGTAACTTCGCAGAAAAGAGTCGGATTACCAAAACACTGCCTGCTCTTCAGACTTAAAGC
ACTGATAGGACTTAAAATAGTCTCATTCAAATACTGTATTTTATATAGGCATTTCACAAA
AACAGCAAAATTGTGGCATTTTGTGAGGCCAAGGCTTGGATGCGTGTGTAATAGAGCCTT
GTGGTGTGTGCGCACACACCCAGAGGGAGAGTTTGAAAAATGCTTATTGGACACGTAACC
TGGCTCTAATTTGGGCTGTTTTTCAGATACACTGTGATAAGTTCTTTTACAAATATCTAT
AGACATGGTAAACTTTTGGTTTTCAGATATGCTTAATGATAGTCTTACTAAATGCAGAAA
TAAGAATAAACTTTCTCAAATTATTAAAAATGCCTACACAGTAAGTGTGAATTGCTGCAA
CAGGTTTGTTCTCAGGAGGGTAAGAACTCCAGGTCTAAACAGCTGACCCAGTGATGGGGA
ATTTATCCTTGACCAATTTATCCTTGACCAATAACCTAATTGTCTATTCCTGAGTTATAA
AAGTCCCCATCCTTATTAGCTCTACTGGAATTTTCATACACGTAAATGCAGAAGTTACTA
AGTATTAAGTATTACTGAGTATTAAGTAGTAATCTGTCAGTTATTAAAATTTGTAAAATC
TATTTATGAAAGGTCATTAAACCAGATCATGTTCCTTTTTTTGTAATCAAGGTGACTAAG
AAAATCAGTTGTGTAAATAAAATCATGTATCATAAAAAAAAAAAAAAAA

Protein Sequence

>5979 : length: 1114
MAKATSGAAGLRLLLLLLLPLLGKVALGLYFSRDAYWEKLYVDQAAGTPLLYVHALRDAP
EEVPSFRLGQHLYGTYRTRLHENNWICIQEDTGLLYLNRSLDHSSWEKLSVRNRGFPLLT
VYLKVFLSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPRELCFPETRPSFRIRENR
PPGTFHQFRLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLEVSTRWALDREQREKYELV
AVCTVHAGAREEVVMVPFPVTVYDEDDSAPTFPAGVDTASAVVEFKRKEDTVVATLRVFD
ADVVPASGELVRRYTSTLLPGDTWAQQTFRVEHWPNETSVQANGSFVRATVHDYRLVLNR
NLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFA
QIGKVCVENCQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSGILFVNDTKALRRPKCAE
LHYMVVATDQQTSRQAQAQLLVTVEGSYVAEEAGCPLSCAVSKRRLECEECGGLGSPTGR
CEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQDINICPQDCLRGSIVGGHEPGEPR
GIKAGYGTCNCFPEEEKCFCEPEDIQDPLCDELCRTVIAAAVLFSFIVSVLLSAFCIHCY
HKFAHKPPISSAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQVSVDAFKILEDPKWEFP
RKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLK
QVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDH
PDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVY
EEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERL
FNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRRDYLDLAA
STPSDSLIYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGMSDPNWPGESPVPLTRA
DGTNTGFPRYPNDSVYANWMLSPSAAKLMDTFDS